2JXC: EPS15-EH2 Stonin2 Complex

Structure of the EPS15-EH2 Stonin2 Complex. Determined by solution NMR. Released 8 Jan 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,069
Mol. weight: 16.01 kDa
Ligands: CA
Released: 8 Jan 2008

Explore 2JXC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JXC contains 7 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	126-138	13
β-strand	142	1	1
β-strand	145-147	3	1
α-helix	148-155	8
α-helix	162-172	11
β-strand	179-181	3	1
α-helix	182-196	15
α-helix	200-202	3
α-helix	212-214	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	334-337	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Epidermal growth factor receptor substrate 15	A	protein	100	Homo sapiens	P42566 (AlphaFold model)
Stonin-2	B	protein	45	Homo sapiens	Q8WXE9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JXC_1 Epidermal growth factor receptor substrate 15 (chains A)
GPLGSPWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDID
HDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR

Sequence of entity 2 (B), FASTA

>2JXC_2 Stonin-2 (chains B)
GPLGSPSVTEASPWRATNPFLNETLQDVQPSPINPFSAFFEEQER

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Structure of the Eps15-stonin2 complex provides a molecular explanation for EH-domain ligand specificity. Rumpf, J., Simon, B., Jung, N. et al. EMBO J (2008) 27:558-569. DOI 10.1038/sj.emboj.7601980 · PubMed

Other PDB entries of the same protein (UniProt P42566 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RHG 1.58 Å, Crystal structure of PTPN3 (PTPH1) D811E, C842S mutant in complex with Eps15 pTyr849…
4RH9 1.6 Å, Crystal structure of PTPN3 (PTPH1) H812F, M883G mutant in complex with Eps15 pTyr849…
4RH5 1.6 Å, Crystal structure of PTPN3 (PTPH1) in complex with Eps15 pTyr849 peptide
4S0G 1.72 Å, Crystal structure of PTPN3 (PTPH1) in complex with Eps15 pTyr849 P850V peptide
2IV9 1.9 Å, B2-appendage from AP2 in complex with Eps15 peptide
5JP2 2.4 Å, Fcho1 Mu homology domain (Danio Rerio) with bound Eps15 peptide
5AWU 2.7 Å, Crystal structure of the SGIP1 mu homology domain in complex with an Eps15 fragment…
5AWT 2.7 Å, Crystal structure of the SGIP1 mu homology domain in complex with an Eps15 fragment…
1C07 Structure of the third EPS15 homology domain of human EPS15
1EH2 Structure of the second EPS15 homology domain of human EPS15, NMR, 20 structures
1F8H Structure of the second EPS15 homology domain of human EPS15 in complex with ptgssstnpfr
1FF1 Structure of the second EPS15 homology domain of human EPS15 in complex with ptgssstnpfl

Browse structure collections

About this viewer

MolViewer shows 2JXC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.