2K0D: Colicin-E7 immunity protein

NMR structure of a mutant colicin e7 immunity protein im7 with an extended helix III. Determined by solution NMR. Released 20 Jan 2009.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 706
Mol. weight: 11.09 kDa
Released: 20 Jan 2009

Explore 2K0D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K0D contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain X: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	11	1	1
α-helix	12-28	17
α-helix	32-45	14
α-helix	50-63	14
α-helix	72-74	3
α-helix	75-86	12
β-strand	92	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Colicin-E7 immunity protein	X	protein	101	Escherichia coli	Q03708 (AlphaFold model)

Sequence of entity 1 (X), FASTA

>2K0D_1 Colicin-E7 immunity protein (chains X)
MEHHHHHHELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTAL
IYEAAARAAANPGGDGGGPEGIVKEIKEWRAANGKPGFKQG

Primary citation

Amino acid insertion reveals a necessary three-helical intermediate in the folding pathway of the colicin E7 immunity protein Im7. Knowling, S.E., Figueiredo, A.M., Whittaker, S.B. et al. J Mol Biol (2009) 392:1074-1086. DOI 10.1016/j.jmb.2009.07.085 · PubMed

Other PDB entries of the same protein (UniProt Q03708 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WNW 1.79 Å, Chaperone Spy bound to Im7 6-45 ensemble
1CEI 1.8 Å, Structure determination of the colicin E7 immunity protein (IMME7) that binds…
1UNK 1.8 Å, Structure of colicin E7 immunity protein
2JB0 1.91 Å, Crystal structure of the mutant H573A of the nuclease domain of COLE7 in complex with IM7
1AYI 2.0 Å, Colicin E7 immunity protein IM7
1MZ8 2.0 Å, Crystal structures of the nuclease domain of COLE7/IM7 in complex with a phosphate ion…
1ZNV 2.0 Å, How a His-metal finger endonuclease ColE7 binds and cleaves DNA with a transition metal…
2ERH 2.0 Å, Crystal Structure of the E7_G/Im7_G complex; a designed interface between the colicin E7…
2JAZ 2.03 Å, Crystal structure of the mutant N560D of the nuclease domain of COLE7 in complex with IM7
1UJZ 2.1 Å, Crystal structure of the E7_C/Im7_C complex; a computationally designed interface…
2JBG 2.2 Å, crystal structure of the mutant N560A of the nuclease domain of ColE7 in complex with Im7
7CEI 2.3 Å, The endonuclease domain of colicin E7 in complex with its inhibitor IM7 protein

Browse structure collections

About this viewer

MolViewer shows 2K0D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.