2K0N: Yeast Gal11p kix domain

Solution Structure of Yeast Gal11p kix domain. Determined by solution NMR. Released 25 Mar 2008.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 655
Mol. weight: 9.41 kDa
Released: 25 Mar 2008

Explore 2K0N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K0N contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	14-35	22
α-helix	41-58	18
α-helix	63-89	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mediator of RNA polymerase II transcription subunit 15	A	protein	85	Saccharomyces cerevisiae	P19659 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K0N_1 Mediator of RNA polymerase II transcription subunit 15 (chains A)
VQDKDTLSNAERAKNVNGLLQVLMDINTLNGGSSDTADKIRIHAKNFEAALFAKSSSKKE
YMDSMNEKVAVMRNTYNTRKNAVTA

Primary citation

A nuclear receptor-like pathway regulating multidrug resistance in fungi. Thakur, J.K., Arthanari, H., Yang, F. et al. Nature (2008) 452:604-609. DOI 10.1038/nature06836 · PubMed

Other PDB entries of the same protein (UniProt P19659 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
7UIC 3.7 Å, Mediator-PIC Early (Tail A)
7UIL 4.3 Å, Mediator-PIC Early (Tail A/B Dimer)
7UIK 7.7 Å, Mediator-PIC Early (Tail A + Upstream DNA & Activator)
2LPB Structure of the complex of the central activation domain of Gcn4 bound to the mediator…
6ALY Solution structure of yeast Med15 ABD2 residues 277-368
8ZZ3 Molecular architecture of the yeast Mediator complex

Browse structure collections

About this viewer

MolViewer shows 2K0N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.