6ALY: Yeast Med15 ABD2 residues 277-368

Solution structure of yeast Med15 ABD2 residues 277-368. Determined by solution NMR. Released 21 Mar 2018.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 738
Mol. weight: 10.53 kDa
Released: 21 Mar 2018

Explore 6ALY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ALY contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	296-299	4
α-helix	302-322	21
α-helix	330-353	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mediator of RNA polymerase II transcription subunit 15	A	protein	92	Saccharomyces cerevisiae	P19659 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ALY_1 Mediator of RNA polymerase II transcription subunit 15 (chains A)
NNPLQQQSSQNTVPNVLNQINQIFSPEEQRSLLQEAIETCKNFEKTQLGSTMTEPVKQSF
IRKYINQKALRKIQALRDVKNNNNANNNGSNL

Primary citation

Gcn4-Mediator Specificity Is Mediated by a Large and Dynamic Fuzzy Protein-Protein Complex. Tuttle, L.M., Pacheco, D., Warfield, L. et al. Cell Rep (2018) 22:3251-3264. DOI 10.1016/j.celrep.2018.02.097 · PubMed

Other PDB entries of the same protein (UniProt P19659 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
7UIC 3.7 Å, Mediator-PIC Early (Tail A)
7UIL 4.3 Å, Mediator-PIC Early (Tail A/B Dimer)
7UIK 7.7 Å, Mediator-PIC Early (Tail A + Upstream DNA & Activator)
2K0N Solution Structure of Yeast Gal11p kix domain
2LPB Structure of the complex of the central activation domain of Gcn4 bound to the mediator…
8ZZ3 Molecular architecture of the yeast Mediator complex

Browse structure collections

About this viewer

MolViewer shows 6ALY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.