2K20: Par-3 PDZ3

Solution structure of Par-3 PDZ3 in complex with PTEN peptide. Determined by solution NMR. Released 10 Jun 2008.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 2
Atoms: 869
Mol. weight: 12.44 kDa
Released: 10 Jun 2008

Explore 2K20 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K20 contains 4 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	9-17	9	1
β-strand	28-34	7	1
β-strand	41-49	9	1
α-helix	54-58	5
α-helix	65	1
β-strand	66-70	5	1
β-strand	73-74	2	1
α-helix	80-89	10
α-helix	90-94	5
β-strand	100-108	9	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	11-12	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Partitioning-defective 3 homolog	A	protein	104	Rattus norvegicus	Q9Z340 (AlphaFold model)
Protein tyrosine phosphatase and tensin homolog	B	protein	11	Rattus norvegicus	O54857 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K20_1 Partitioning-defective 3 homolog (chains A)
GTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQ
LIAVNGESLLGKANQEAMETLRRSMSTEGNKRGMIQLIVARRIS

Sequence of entity 2 (B), FASTA

>2K20_2 Protein tyrosine phosphatase and tensin homolog (chains B)
DEDQHSQITKV

Primary citation

Solution structure of Par-3 PDZ3 in complex with PTEN peptide. Feng, W., Wu, H., Chan, L. et al. To be published.

Other PDB entries of the same protein (UniProt Q9Z340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JUE 1.55 Å, The complex of PDZ and PBM
4DC2 2.4 Å, Structure of PKC in Complex with a Substrate Peptide from Par-3
9IMP 2.87 Å, The complex of PDZ3 and PBM
4I6P 2.9 Å, Crystal structure of Par3-NTD domain
3ZEE 6.1 Å, Electron cyro-microscopy helical reconstruction of Par-3 N terminal domain
2K1Z Solution structure of Par-3 PDZ3
2NS5 The conserved N-terminal domain of Par-3 adopts a novel PB1-like structure required for…
2OGP Solution structure of the second PDZ domain of Par-3

Browse structure collections

About this viewer

MolViewer shows 2K20 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.