3ZEE: Partitioning defective 3 homolog

Electron cyro-microscopy helical reconstruction of Par-3 N terminal domain. Determined by electron microscopy at 6.1 Å resolution. Released 16 Oct 2013.

Method: Electron microscopy
Resolution: 6.1 Å
Organism: RATTUS NORVEGICUS
Chains: 1
Atoms: 670
Mol. weight: 9.55 kDa
Released: 16 Oct 2013

Explore 3ZEE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZEE contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	7	1	2
β-strand	12-15	4	1
β-strand	22	1	3
α-helix	23-38	16
β-strand	47-52	6	2
β-strand	58	1	2
α-helix	59-60	2
β-strand	64	1	3
α-helix	65-68	4
β-strand	74	1	1
β-strand	76-80	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Partitioning defective 3 homolog	A	protein	84	RATTUS NORVEGICUS	Q9Z340 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3ZEE_1 PARTITIONING DEFECTIVE 3 HOMOLOG (chains A)
SEFKVTVCFGRTRVVVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGI
LDLDDILCDVADDKDRLVAVFDEQ

Primary citation

Structural Insights Into the Intrinsic Self-Assembly of Par-3 N-Terminal Domain. Zhang, Y., Wang, W., Chen, J. et al. Structure (2013) 21:997. DOI 10.1016/J.STR.2013.04.004 · PubMed

Other PDB entries of the same protein (UniProt Q9Z340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JUE 1.55 Å, The complex of PDZ and PBM
4DC2 2.4 Å, Structure of PKC in Complex with a Substrate Peptide from Par-3
9IMP 2.87 Å, The complex of PDZ3 and PBM
4I6P 2.9 Å, Crystal structure of Par3-NTD domain
2K1Z Solution structure of Par-3 PDZ3
2K20 Solution structure of Par-3 PDZ3 in complex with PTEN peptide
2NS5 The conserved N-terminal domain of Par-3 adopts a novel PB1-like structure required for…
2OGP Solution structure of the second PDZ domain of Par-3

Browse structure collections

About this viewer

MolViewer shows 3ZEE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.