4I6P: Par3-NTD domain

Crystal structure of Par3-NTD domain. Determined by X-ray diffraction at 2.9 Å resolution. Released 17 Jul 2013.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 1,357
Mol. weight: 19.76 kDa
Released: 17 Jul 2013

Explore 4I6P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4I6P contains 5 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1-7	7	1
β-strand	10-17	8	1
β-strand	22	1	2
α-helix	23-38	16
β-strand	46-52	7	1
α-helix	57	1
β-strand	58	1	1
α-helix	59-60	2
β-strand	64	1	2
α-helix	65-68	4
β-strand	74-81	8	1

Chain B: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1-7	7	1
β-strand	10-17	8	1
β-strand	22	1	3
α-helix	23-38	16
β-strand	47-52	6	1
β-strand	57-59	3	1
β-strand	64	1	3
β-strand	74-80	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Partitioning defective 3 homolog	A, B	protein	88	Rattus norvegicus	Q9Z340 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4I6P_1 Partitioning defective 3 homolog (chains A, B)
GPGSEFKVTVCFGRTRVVVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGD
GGILDLDDILCDVADDKDRLVAVFDEQD

Primary citation

Structural insights into the intrinsic self-assembly of par-3 N-terminal domain. Zhang, Y., Wang, W., Chen, J. et al. Structure (2013) 21:997-1006. DOI 10.1016/j.str.2013.04.004 · PubMed

Other PDB entries of the same protein (UniProt Q9Z340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JUE 1.55 Å, The complex of PDZ and PBM
4DC2 2.4 Å, Structure of PKC in Complex with a Substrate Peptide from Par-3
9IMP 2.87 Å, The complex of PDZ3 and PBM
3ZEE 6.1 Å, Electron cyro-microscopy helical reconstruction of Par-3 N terminal domain
2K1Z Solution structure of Par-3 PDZ3
2K20 Solution structure of Par-3 PDZ3 in complex with PTEN peptide
2NS5 The conserved N-terminal domain of Par-3 adopts a novel PB1-like structure required for…
2OGP Solution structure of the second PDZ domain of Par-3

Browse structure collections

About this viewer

MolViewer shows 4I6P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.