2NS5: Partitioning-defective 3 homolog

The conserved N-terminal domain of Par-3 adopts a novel PB1-like structure required for Par-3 oligomerization and apical membrane localization. Determined by solution NMR. Released 4 Sept 2007.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 1
Atoms: 679
Mol. weight: 9.68 kDa
Released: 4 Sept 2007

Explore 2NS5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NS5 contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	18-24	7	1
β-strand	27-33	7	1
α-helix	40-54	15
β-strand	63-69	7	1
β-strand	75-76	2	1
α-helix	82-85	4
β-strand	90-98	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Partitioning-defective 3 homolog	A	protein	85	Rattus norvegicus	Q9Z340 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2NS5_1 Partitioning-defective 3 homolog (chains A)
SEFKVTVCFGRTRVDVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGI
LDLDDILCDVADDKDRLVAVFDEQD

Primary citation

The Par-3 NTD adopts a PB1-like structure required for Par-3 oligomerization and membrane localization. Feng, W., Wu, H., Chan, L.-N. et al. EMBO J (2007) 26:2786-2796. DOI 10.1038/sj.emboj.7601702 · PubMed

Other PDB entries of the same protein (UniProt Q9Z340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JUE 1.55 Å, The complex of PDZ and PBM
4DC2 2.4 Å, Structure of PKC in Complex with a Substrate Peptide from Par-3
9IMP 2.87 Å, The complex of PDZ3 and PBM
4I6P 2.9 Å, Crystal structure of Par3-NTD domain
3ZEE 6.1 Å, Electron cyro-microscopy helical reconstruction of Par-3 N terminal domain
2K1Z Solution structure of Par-3 PDZ3
2K20 Solution structure of Par-3 PDZ3 in complex with PTEN peptide
2OGP Solution structure of the second PDZ domain of Par-3

Browse structure collections

About this viewer

MolViewer shows 2NS5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.