2K7O: Ca2+-S100B, refined with RDCs

Ca2+-S100B, refined with RDCs. Determined by solution NMR. Released 18 Nov 2008.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 2
Atoms: 1,490
Mol. weight: 21.41 kDa
Ligands: CA
Released: 18 Nov 2008

Explore 2K7O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K7O contains 8 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-18	17
β-strand	27	1	1
α-helix	29-38	10
α-helix	50-60	11
β-strand	68	1	1
α-helix	70-83	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein S100-B	A, B	protein	91	Rattus norvegicus	P04631 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2K7O_1 Protein S100-B (chains A, B)
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETL
DEDGDGECDFQEFMAFVSMVTTACHEFFEHE

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

Refinement of the solution structure and dynamic properties of Ca(2+)-bound rat S100B. Wright, N.T., Inman, K.G., Levine, J.A. et al. J Biomol NMR (2008) 42:279-286. DOI 10.1007/s10858-008-9282-y · PubMed

Other PDB entries of the same protein (UniProt P04631 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1B4C Solution structure of rat apo-S100B using dipolar couplings
1DT7 Solution structure of the C-terminal negative regulatory domain of P53 in a complex with…
1MWN Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12
1QLK Solution structure of CA(2+)-loaded rat S100B (betabeta) NMR, 20 structures
1SYM 3-D solution structure of reduced apo-S100B from rat, NMR, 20 structures
1XYD NMR Solution Structure of Rat Zinc-Calcium-S100B, 20 Structures

Browse structure collections

About this viewer

MolViewer shows 2K7O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.