2K86: FOXO3a Forkhead domain

Solution Structure of FOXO3a Forkhead domain. Determined by solution NMR. Released 14 Oct 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 824
Mol. weight: 11.71 kDa
Released: 14 Oct 2008

Explore 2K86 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K86 contains 4 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	162-171	10
β-strand	178	1	1
α-helix	180-190	11
α-helix	193-199	7
α-helix	203-213	11
β-strand	220-224	5	1
β-strand	232-236	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Forkhead box protein O3	A	protein	103	Homo sapiens	O43524 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K86_1 Forkhead box protein O3 (chains A)
GSSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKN
SIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRA

Primary citation

Biochemical and structural characterization of an intramolecular interaction in FOXO3a and its binding with p53. Wang, F., Marshall, C.B., Yamamoto, K. et al. J Mol Biol (2008) 384:590-603. DOI 10.1016/j.jmb.2008.09.025 · PubMed

Other PDB entries of the same protein (UniProt O43524 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QNG 1.35 Å, FOXO3 pS413 phosphopeptide binding to 14-3-3sigma
7V9B 1.85 Å, Crystal Structure of 14-3-3 epsilon with FOXO3a peptide
2UZK 2.7 Å, Crystal structure of the human FOXO3a-DBD bound to DNA
2LQH NMR structure of FOXO3a transactivation domains (CR2C-CR3) in complex with CBP KIX…
2LQI NMR structure of FOXO3a transactivation domains (CR2C-CR3) in complex with CBP KIX…
6MNL NMR solution structures of second bromodomain of BRD4 with FOXO3a peptide

Browse structure collections

About this viewer

MolViewer shows 2K86 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.