2KAV: Sodium channel protein type 2 subunit alpha

Solution structure of the human Voltage-gated Sodium Channel, brain isoform (Nav1.2). Determined by solution NMR. Released 6 Jan 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 851
Mol. weight: 14.59 kDa
Released: 6 Jan 2009

Explore 2KAV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KAV contains 6 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	1792-1805	14
β-strand	1812-1813	2	1
α-helix	1815-1817	3
α-helix	1818-1824	7
α-helix	1837-1841	5
β-strand	1846-1847	2	1
β-strand	1851-1853	3	1
α-helix	1854-1864	11
α-helix	1872-1878	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium channel protein type 2 subunit alpha	A	protein	129	Homo sapiens	Q99250 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KAV_1 Sodium channel protein type 2 subunit alpha (chains A)
MGSSHHHHHHSSGLVPRGSHMASENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFI
EFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMD
ALRIQMEER

Primary citation

Solution structure of the NaV1.2 C-terminal EF-hand domain. Miloushev, V.Z., Levine, J.A., Arbing, M.A. et al. J Biol Chem (2009) 284:6446-6454. DOI 10.1074/jbc.M807401200 · PubMed

Other PDB entries of the same protein (UniProt Q99250 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RLY 2.5 Å, Crystal Structure of AnkB Ankyrin Repeats (R1-R9) in Complex with Nav1.2 Ankyrin Binding…
6J8E 3.0 Å, Human Nav1.2-beta2-KIIIA ternary complex
4JPZ 3.02 Å, Voltage-gated sodium channel 1.2 C-terminal domain in complex with FGF13U and…
6BUT Solution structure of full-length apo mammalian calmodulin bound to the IQ motif of the…

Browse structure collections

About this viewer

MolViewer shows 2KAV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.