4RLY: AnkB Ankyrin Repeats

Crystal Structure of AnkB Ankyrin Repeats (R1-R9) in Complex with Nav1.2 Ankyrin Binding Domain. Determined by X-ray diffraction at 2.5 Å resolution. Released 26 Nov 2014.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Mus musculus, Homo sapiens
Chains: 1
Atoms: 2,371
Mol. weight: 35.48 kDa
Released: 26 Nov 2014

Explore 4RLY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RLY contains 22 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1126-1128	3
α-helix	2030-2041	12
α-helix	2044-2052	9
β-strand	2060	1	1
β-strand	2066	1	1
α-helix	2067-2074	8
α-helix	2077-2086	10
α-helix	2100-2106	7
α-helix	2110-2118	9
α-helix	2133-2139	7
α-helix	2143-2150	8
α-helix	2166-2172	7
α-helix	2176-2183	8
α-helix	2195-2202	8
α-helix	2205-2211	7
α-helix	2212-2214	3
α-helix	2225-2227	3
α-helix	2236-2243	8
α-helix	2246-2254	9
β-strand	2263	1	2
α-helix	2264-2266	3
β-strand	2267	1	2
α-helix	2269-2275	7
α-helix	2279-2287	9
α-helix	2302-2307	6
α-helix	2312-2321	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nav1.2 - AnkB chimera	A	protein	329	Mus musculus, Homo sapiens	Q01484 (AlphaFold model), Q99250 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4RLY_1 Nav1.2 - AnkB chimera (chains A)
GSTVTVPIAVGESDFENLNTEGSLVPRGSKSDSNASFLRAARAGNLDKVVEYLKGGIDIN
TCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVK
EGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQA
VAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLH
IAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD
GLTPLHCAARSGHDQVVELLKVVTEEVTT

Primary citation

Structural basis of diverse membrane target recognitions by ankyrins. Wang, C., Wei, Z., Chen, K. et al. Elife (2014) 3:e04353. DOI 10.7554/eLife.04353 · PubMed

Other PDB entries of the same protein (UniProt Q01484 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KZJ 1.5 Å, Crystal structure of Ankyrin B/NdeL1 complex
5Y4F 1.95 Å, Crystal Structure of AnkB Ankyrin Repeats R13-24 in complex with autoinhibition segment…
8ZE8 2.07 Å, Arf-GTPase activating protein Asap1 SH3 domain in complex with 440 Kd Ankyrin-B fragment
5YIS 2.2 Å, Crystal Structure of AnkB LIR/LC3B complex
4D8O 2.2 Å, Crystal Structure of the ankyrin-B ZU5-ZU5-UPA-DD tandem
5Y4E 2.34 Å, Crystal Structure of AnkB Ankyrin Repeats R8-14 in complex with autoinhibition segment…
5YIR 2.75 Å, Crystal Structure of AnkB LIR/GABARAP complex
5Y4D 3.3 Å, Crystal Structure of AnkB Ankyrin Repeats in Complex with AnkR/AnkB Chimeric…
6M3Q 3.44 Å, Crystal structure of AnkB/beta4-spectrin complex
4RLV 3.49 Å, Crystal Structure of AnkB 24 Ankyrin Repeats in Complex with AnkR Autoinhibition Segment

Browse structure collections

About this viewer

MolViewer shows 4RLY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.