2KEB: DNA polymerase subunit alpha B

NMR solution structure of the N-terminal domain of the DNA polymerase alpha p68 subunit. Determined by solution NMR. Released 2 Feb 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 607
Mol. weight: 11.15 kDa
Released: 2 Feb 2010

Explore 2KEB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KEB contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-15	11
β-strand	18	1	1
α-helix	21-34	14
α-helix	38-52	15
β-strand	56	1	1
α-helix	59-65	7
α-helix	66-70	5
α-helix	71-73	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA polymerase subunit alpha B	A	protein	101	Homo sapiens	Q14181 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KEB_1 DNA polymerase subunit alpha B (chains A)
MGSSHHHHHHGSSLEVLFQGPGSMSASAQQLAEELQIFGLDCEEALIEKLVELCVQYGQN
EEGMVGELIAFCTSTHKVGLTSEILNSFEHEFLSKRLSKAR

Primary citation

Structure of a DNA polymerase alpha-primase domain that docks on the SV40 helicase and activates the viral primosome. Huang, H., Weiner, B.E., Zhang, H. et al. J Biol Chem (2010) 285:17112-17122. DOI 10.1074/jbc.M110.116830 · PubMed

Other PDB entries of the same protein (UniProt Q14181 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Y97 2.51 Å, Crystal Structure of human Pol alpha B-subunit in complex with C-terminal domain of…
8VY3 2.98 Å, Human DNA polymerase alpha/primase - AavLEA1 (1:40 molar ratio)
8QJ7 3.07 Å, Cryo-EM structure of human DNA polymerase alpha-primase in pre-initiation stage 1
9C8V 3.39 Å, Human DNA polymerase alpha/primase - CHAPSO (4 mM)
8B9D 3.4 Å, Human replisome bound by Pol Alpha
8D0B 3.43 Å, Human CST-DNA polymerase alpha/primase preinitiation complex bound to 4xTEL-foldback…
8D9D 3.59 Å, Human DNA polymerase-alpha/primase elongation complex II bound to primer/template
5EXR 3.6 Å, Crystal structure of human primosome
7OPL 4.12 Å, CryoEM structure of DNA Polymerase alpha - primase bound to SARS CoV nsp1
8D0K 4.27 Å, Human CST-DNA polymerase alpha/primase preinitiation complex bound to 4xTEL-foldback…
7U5C 4.6 Å, Cryo-EM structure of human CST bound to DNA polymerase alpha-primase in a recruitment…
4E2I 5.0 Å, The Complex Structure of the SV40 Helicase Large T Antigen and p68 Subunit of DNA…

Browse structure collections

About this viewer

MolViewer shows 2KEB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.