NMR solution structure of the EH 1 domain from human intersectin-1 protein. Northeast Structural Genomics Consortium target HR3646E. Determined by solution NMR. Released 21 Apr 2009.
Explore 2KHN in 3D Show helices and sheets RCSB PDB PDBe
2KHN contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 29-41 | 13 | |
| α-helix | 51-60 | 10 | |
| α-helix | 65-75 | 11 | |
| α-helix | 85-98 | 14 | |
| α-helix | 110-113 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Intersectin-1 | A | protein | 121 | Homo sapiens | Q15811 (AlphaFold model) |
>2KHN_1 Intersectin-1 (chains A) MGHHHHHHSHMAQFPTPFGGSLDTWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQ SGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAIS S
NMR solution structure of the EH 1 domain from human intersectin-1 protein. Northeast Structural Genomics Consortium target HR3646E. Mills, J.L., Ghosh, A., Garcia, E. et al. To be published.
Other PDB entries of the same protein (UniProt Q15811 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2KHN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.