2KIN: Kinesin (monomeric) from rattus norvegicus

Kinesin (monomeric) from rattus norvegicus. Determined by X-ray diffraction at 2.0 Å resolution. Released 8 Apr 1998.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 2,933
Mol. weight: 38.96 kDa
Ligands: ADP
Released: 8 Apr 1998

Explore 2KIN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KIN contains 19 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	1
α-helix	9	1
β-strand	10-15	6	2
α-helix	16-18	3
α-helix	20-24	5
β-strand	29	1	3
β-strand	31-34	4	4
β-strand	38-41	4	4
α-helix	45-46	2
β-strand	47-48	2	4
β-strand	51-53	3	2
α-helix	59-66	8
α-helix	68-75	8
β-strand	79-85	7	2
α-helix	92-96	5
β-strand	98	1	5
β-strand	106	1	5
α-helix	108-121	14
β-strand	127-139	13	2
β-strand	142-145	4	2
β-strand	154	1	2
α-helix	155	1
β-strand	156-158	3	6
β-strand	164-166	3	6
β-strand	172-174	3	2
α-helix	177-192	16
α-helix	198-204	7
β-strand	206-217	12	2
β-strand	223-232	10	2
α-helix	233-235	3
β-strand	238	1	7

Chain B: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	254	1	7
α-helix	257-271	15
α-helix	279-281	3
α-helix	283-287	5
α-helix	289-293	5
β-strand	296-304	9	2
β-strand	307	1	3
α-helix	308-310	3
α-helix	311-325	15
β-strand	328-331	4	1
β-strand	334-336	3	2
α-helix	339-350	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin	A	protein	238	Rattus norvegicus	P56536 (AlphaFold model)
Kinesin	B	protein	100	Rattus norvegicus	Q6QLM7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KIN_1 KINESIN (chains A)
ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQEQ
VYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVM
DVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKV

Sequence of entity 2 (B), FASTA

>2KIN_2 KINESIN (chains B)
AKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLDGNCRTTIVICCSPSVFNE
AETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKE

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

X-ray structure of motor and neck domains from rat brain kinesin. Sack, S., Muller, J., Marx, A. et al. Biochemistry (1997) 36:16155-16165. DOI 10.1021/bi9722498 · PubMed

Other PDB entries of the same protein (UniProt P56536 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HLE 2.9 Å, Structural basis of backwards motion in kinesin-14: minus-end directed nKn664 in the ADP…
3KIN 3.1 Å, Kinesin (dimeric) from rattus norvegicus
5HNZ 5.8 Å, Structural basis of backwards motion in kinesin-14: plus-end directed nKn669 in the…
5HNY 6.3 Å, Structural basis of backwards motion in kinesin-14: plus-end directed nKn669 in the…
5HNW 6.6 Å, Structural basis of backwards motion in kinesin-14: minus-end directed nKn664 in the…
5HNX 6.6 Å, Structural basis of backwards motion in kinesin-14: minus-end directed nKn664 in the…
8TT7 NMR Assignments and Structure for the Dimeric Kinesin Neck Domain

Browse structure collections

About this viewer

MolViewer shows 2KIN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.