2KPL: Magi-1 PDZ1 / E6CT

Magi-1 PDZ1 / E6CT. Determined by solution NMR. Released 27 Oct 2010.

Method: Solution NMR
Organisms: Homo sapiens, Human papillomavirus type 16
Chains: 2
Atoms: 1,071
Mol. weight: 15.25 kDa
Released: 27 Oct 2010

Explore 2KPL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KPL contains 4 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	14-22	9	1
β-strand	29-36	8	1
β-strand	39-46	8	1
α-helix	47	1
α-helix	51-55	5
β-strand	60	1	2
β-strand	62	1	2
β-strand	63-67	5	1
β-strand	70	1	1
α-helix	77-86	10
α-helix	87-88	2
β-strand	91-99	9	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	157-160	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1	A	protein	129	Homo sapiens	Q96QZ7 (AlphaFold model)
Protein E6	B	protein	11	Human papillomavirus type 16	P03126 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KPL_1 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (chains A)
GAMGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDG
KMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPLPFDPDDPNTSLVT
SVAILDKEP

Sequence of entity 2 (B), FASTA

>2KPL_2 Protein E6 (chains B)
RSSRTRRETQV

Primary citation

The structural and dynamic response of MAGI-1 PDZ1 with non-canonical domain boundaries to binding of human papillomavirus (HPV) E6. Charbonnier, S., Nomine, Y., Ramirez, J. et al. J Mol Biol (2011). DOI 10.1016/j.jmb.2011.01.015 · PubMed

Other PDB entries of the same protein (UniProt Q96QZ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BPU 1.6 Å, Crystal structure of the 3rd PDZ domain of human membrane associated guanylate kinase,…
2Q9V 2.0 Å, Crystal structure of the C890S mutant of the 4th PDZ domain of human membrane associated…
2R4H 2.05 Å, Crystal structure of a C1190S mutant of the 6th PDZ domain of human membrane associated…
5N7D 2.3 Å, MAGI-1 complexed with a RSK1 peptide
5N7F 2.3 Å, MAGI-1 complexed with a pRSK1 peptide
6TWX 2.3 Å, MAGI1_2 complexed with a phosphorylated 16E6 peptide
6TWY 2.3 Å, MAGI1_2 complexed with a phosphomimetic RSK1 peptide
1WBP 2.4 Å, SRPK1 bound to 9mer docking motif peptide
6TWU 2.4 Å, MAGI1_2 complexed with a phosphomimetic 16E6 peptide
7P71 2.6 Å, The PDZ domain of MAGI1_2 complexed with the PDZ-binding motif of HPV35-E6
5N7G 2.95 Å, MAGI-1 complexed with a synthetic pRSK1 peptide
2KPK Magi-1 PDZ1

Browse structure collections

About this viewer

MolViewer shows 2KPL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.