Crystal structure of NEDD4 HECT domain in complex with covalent inhibitor. Determined by X-ray diffraction at 2.17 Å resolution. Released 4 Jun 2025.
Explore 9H9T in 3D Show helices and sheets RCSB PDB PDBe
9H9T contains 28 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 522-532 | 11 | |
| α-helix | 534-536 | 3 | |
| β-strand | 542-547 | 6 | 1 |
| α-helix | 549-551 | 3 | |
| α-helix | 552-560 | 9 | |
| α-helix | 566-570 | 5 | |
| β-strand | 572-577 | 6 | 1 |
| α-helix | 587-600 | 14 | |
| α-helix | 603-605 | 3 | |
| β-strand | 608-610 | 3 | 2 |
| β-strand | 618-620 | 3 | 2 |
| α-helix | 624-627 | 4 | |
| α-helix | 631-647 | 17 | |
| β-strand | 656 | 1 | 2 |
| α-helix | 658-664 | 7 | |
| α-helix | 667-669 | 3 | |
| α-helix | 671-675 | 5 | |
| α-helix | 679-690 | 12 | |
| α-helix | 694-696 | 3 | |
| β-strand | 699 | 1 | 3 |
| β-strand | 701-706 | 6 | 4 |
| β-strand | 709-714 | 6 | 4 |
| α-helix | 719-721 | 3 | |
| β-strand | 723 | 1 | 3 |
| α-helix | 729-741 | 13 | |
| α-helix | 743-745 | 3 | |
| α-helix | 746-757 | 12 | |
| α-helix | 762-765 | 4 | |
| α-helix | 770-778 | 9 | |
| α-helix | 785-790 | 6 | |
| β-strand | 792-795 | 4 | 5 |
| α-helix | 803-813 | 11 | |
| α-helix | 817-828 | 12 | |
| α-helix | 832-834 | 3 | |
| α-helix | 838-840 | 3 | |
| β-strand | 842 | 1 | 6 |
| β-strand | 847 | 1 | 6 |
| β-strand | 850-854 | 5 | 5 |
| α-helix | 861-862 | 2 | |
| β-strand | 863-865 | 3 | 5 |
| α-helix | 866-868 | 3 | |
| β-strand | 870-873 | 4 | 5 |
| α-helix | 879-890 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Isoform 4 of E3 ubiquitin-protein ligase NEDD4 | A | protein | 375 | Homo sapiens | P46934 (AlphaFold model) |
>9H9T_1 Isoform 4 of E3 ubiquitin-protein ligase NEDD4 (chains A) SRDYKRKYEFFRRKLKKQNDIPNKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFD GEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFI GRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDL RFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFE LIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSE KRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYES FEELWDKLQMAIENT
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1ITT | ethyl 4-[4-(2-chloranyl-5,6-dihydrobenzo[b][1]benzazepin-11-yl)butylamino]butan… | C24 H31 Cl N2 O2 | 1 |
Structure-based design of potent and selective inhibitors of the HECT ligase NEDD4. Maspero, E., Cappa, A., Weber, J. et al. Commun Chem (2025) 8:164-164. DOI 10.1038/s42004-025-01557-4 · PubMed
Other PDB entries of the same protein (UniProt P46934 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9H9T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.