2XBF: Nedd4 HECT structure

Nedd4 HECT structure. Determined by X-ray diffraction at 2.5 Å resolution. Released 23 Mar 2011.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 3,390
Mol. weight: 46.07 kDa
Ligands: CA
Released: 23 Mar 2011

Explore 2XBF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XBF contains 27 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	522-532	11
α-helix	534-536	3
β-strand	542-547	6	1
α-helix	549-551	3
α-helix	552-560	9
α-helix	566-570	5
β-strand	572-577	6	1
α-helix	585-600	16
α-helix	603-605	3
β-strand	608-610	3	2
β-strand	618-620	3	2
α-helix	624-627	4
α-helix	631-647	17
β-strand	656	1	2
α-helix	658-664	7
α-helix	667-669	3
α-helix	671-675	5
α-helix	679-690	12
α-helix	694-696	3
β-strand	699	1	3
β-strand	701-706	6	4
β-strand	709-714	6	4
α-helix	719-721	3
β-strand	723	1	3
α-helix	729-741	13
α-helix	743-745	3
α-helix	746-756	11
α-helix	762-765	4
α-helix	770-778	9
α-helix	785-790	6
β-strand	792-795	4	5
α-helix	803-814	12
α-helix	817-828	12
α-helix	838-840	3
β-strand	842	1	6
β-strand	847	1	6
β-strand	850-854	5	5
α-helix	861-862	2
β-strand	863-865	3	5
α-helix	866-868	3
β-strand	870-873	4	5
α-helix	879-891	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase NEDD4	A	protein	386	HOMO SAPIENS	P46934 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2XBF_1 E3 UBIQUITIN-PROTEIN LIGASE NEDD4 (chains A)
GPLGSRDYKRKYEFFRRKLKKQNDIPNKFEMKLRRATVLEDSYRRIMGVKRADFLKARLW
IEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSY
FKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPT
ELDLRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKE
GFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLM
MDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLP
PYESFEELWDKLQMAIENTQGFDGVD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Structure of the Hect:Ubiquitin Complex and its Role in Ubiquitin Chain Elongation. Maspero, E., Mari, S., Valentini, E. et al. EMBO Rep (2011) 12:342. DOI 10.1038/EMBOR.2011.21 · PubMed

Other PDB entries of the same protein (UniProt P46934 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N7F 1.1 Å, Crystal structure of 3rd WW domain of human Nedd4-1
4N7H 1.7 Å, Crystal Structure of the Complex of 3rd WW domain of Human Nedd4 and 1st PPXY Motif of…
3B7Y 1.8 Å, Crystal structure of the C2 Domain of the E3 Ubiquitin-Protein Ligase NEDD4
9H9O 2.12 Å, Crystal structure of NEDD4 HECT domain in complex with norclomipramine
9H9T 2.17 Å, Crystal structure of NEDD4 HECT domain in complex with covalent inhibitor
5C91 2.44 Å, NEDD4 HECT with covalently bound indole-based inhibitor
4BBN 2.51 Å, NEDD4 HECT-Ub:Ub complex
2XBB 2.68 Å, Nedd4 HECT:Ub complex
4BE8 3.0 Å, NEDD4 HECT A889F structure
5C7J 3.0 Å, Crystal structure of NEDD4 with a ub variant
2KPZ Human NEDD4 3RD WW Domain Complex with The Human T-cell Leukemia virus 1 GAG-Pro…
2KQ0 Human NEDD4 3rd WW Domain Complex with Ebola Zaire Virus Matrix Protein VP40 Derived…

Browse structure collections

About this viewer

MolViewer shows 2XBF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.