Crystal structure of NEDD4 with a ub variant. Determined by X-ray diffraction at 3.0 Å resolution. Released 16 Mar 2016.
Explore 5C7J in 3D Show helices and sheets RCSB PDB PDBe
5C7J contains 62 α-helices and 44 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 522-532 | 11 | |
| α-helix | 534-536 | 3 | |
| β-strand | 542-547 | 6 | 1 |
| α-helix | 549-551 | 3 | |
| α-helix | 552-561 | 10 | |
| α-helix | 566-570 | 5 | |
| β-strand | 572-577 | 6 | 1 |
| α-helix | 585-600 | 16 | |
| α-helix | 603-605 | 3 | |
| β-strand | 608-610 | 3 | 2 |
| β-strand | 618-620 | 3 | 2 |
| α-helix | 624-627 | 4 | |
| α-helix | 631-647 | 17 | |
| β-strand | 652 | 1 | 3 |
| β-strand | 656 | 1 | 2 |
| α-helix | 658-664 | 7 | |
| α-helix | 673-677 | 5 | |
| α-helix | 679-690 | 12 | |
| α-helix | 693-696 | 4 | |
| β-strand | 699 | 1 | 4 |
| β-strand | 701-706 | 6 | 5 |
| β-strand | 709-714 | 6 | 5 |
| α-helix | 719-721 | 3 | |
| α-helix | 722 | 1 | |
| β-strand | 723 | 1 | 4 |
| α-helix | 724 | 1 | |
| α-helix | 726-728 | 3 | |
| α-helix | 729-741 | 13 | |
| α-helix | 743-745 | 3 | |
| α-helix | 746-759 | 14 | |
| α-helix | 762-765 | 4 | |
| α-helix | 770-777 | 8 | |
| β-strand | 778 | 1 | 3 |
| α-helix | 785-790 | 6 | |
| β-strand | 792-795 | 4 | 6 |
| α-helix | 803-814 | 12 | |
| α-helix | 817-827 | 11 | |
| β-strand | 850-853 | 4 | 6 |
| α-helix | 861-862 | 2 | |
| β-strand | 863-865 | 3 | 6 |
| β-strand | 870-872 | 3 | 6 |
| α-helix | 879-894 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -14--7 | 8 | |
| β-strand | 3-7 | 5 | 13 |
| β-strand | 12-15 | 4 | 13 |
| β-strand | 22 | 1 | 14 |
| α-helix | 23-34 | 12 | |
| α-helix | 38-40 | 3 | |
| β-strand | 42-45 | 4 | 13 |
| β-strand | 48-49 | 2 | 13 |
| α-helix | 50-51 | 2 | |
| β-strand | 55 | 1 | 14 |
| β-strand | 67-70 | 4 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase NEDD4 | A, B | protein | 382 | Homo sapiens | P46934 (AlphaFold model) |
| Polyubiquitin-C | C, D | protein | 92 | Homo sapiens | P0CG48 (AlphaFold model) |
>5C7J_1 E3 ubiquitin-protein ligase NEDD4 (chains A, B) GRDYKRKYEFFRRKLKKQNDIPNKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFD GEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFI GRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDL RFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFE LIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSE KRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYES FEELWDKLQMAIENTQGFDGVD
>5C7J_2 Polyubiquitin-C (chains C, D) AHHHHHHVTSLYKKAGSTMQIFVKTLAGWGITLEVEPSDTIENVKAKIQDKEGIPPDQQR LIFAGKQLEDGRTLSDYNIRYDSQLHLVGRLR
System-Wide Modulation of HECT E3 Ligases with Selective Ubiquitin Variant Probes. Zhang, W., Wu, K.P., Sartori, M.A. et al. Mol Cell (2016) 62:121-136. DOI 10.1016/j.molcel.2016.02.005 · PubMed
Other PDB entries of the same protein (UniProt P46934 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5C7J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.