2KXQ: Smurf2 WW2 and WW3

Solution Structure of Smurf2 WW2 and WW3 bound to Smad7 PY motif containing peptide. Determined by solution NMR. Released 13 Oct 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 869
Mol. weight: 12.3 kDa
Released: 13 Oct 2010

Explore 2KXQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KXQ contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	258-262	5	1
β-strand	266-271	6	1
β-strand	276-278	3	1
α-helix	293-295	3
α-helix	298-300	3
β-strand	305-307	3	1
β-strand	313-317	5	1
β-strand	322-324	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase SMURF2	A	protein	90	Homo sapiens	Q9HAU4 (AlphaFold model)
Smad7 PY motif containing peptide	B	protein	20	Homo sapiens	O15105 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KXQ_1 E3 ubiquitin-protein ligase SMURF2 (chains A)
GPLGGSPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGW
EIRNTATGRVYFVDHNNRTTQFTDPRLSAN

Sequence of entity 2 (B), FASTA

>2KXQ_2 Smad7 PY motif containing peptide (chains B)
GPLGSELESPPPPYSRYPMD

Primary citation

Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Chong, P.A., Lin, H., Wrana, J.L. et al. Proc Natl Acad Sci U S A (2010) 107:18404-18409. DOI 10.1073/pnas.1003023107 · PubMed

Other PDB entries of the same protein (UniProt Q9HAU4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9FSH 2.08 Å, Crystal structure of the HECT domain of Smurf 2 in complex with inhibitor 8
1ZVD 2.1 Å, Regulation of Smurf2 Ubiquitin Ligase Activity by Anchoring the E2 to the HECT domain
6FX4 2.5 Å, Disulfide between E3 HECT ligase Smurf2 and Ubiquitin G76C
7M3Q 2.5 Å, Structure of the Smurf2 HECT Domain with a High Affinity Ubiquitin Variant (UbV)
2DJY Solution structure of Smurf2 WW3 domain-Smad7 PY peptide complex
2JQZ Solution Structure of the C2 domain of human Smurf2
2LTZ Smurf2 WW3 domain in complex with a Smad7 derived peptide

Browse structure collections

About this viewer

MolViewer shows 2KXQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.