2L23: PDB entry 2L23

NMR structure of the ACID (ACtivator Interacting Domain) of the human mediator Med25 protein. Determined by solution NMR. Released 24 Nov 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,290
Mol. weight: 19.22 kDa
Released: 24 Nov 2010

Explore 2L23 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L23 contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	10-20	11	1
β-strand	35-44	10	1
β-strand	58-65	8	1
α-helix	66-72	7
α-helix	73-76	4
β-strand	79-86	8	1
α-helix	92-104	13
β-strand	105-110	6	1
β-strand	122-127	6	1
β-strand	132-138	7	1
α-helix	141-150	10
α-helix	153-155	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mediator of RNA polymerase II transcription subunit 25	A	protein	167	Homo sapiens	Q71SY5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L23_1 Mediator of RNA polymerase II transcription subunit 25 (chains A)
MGQQSVSNKLLAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLI
MQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLESLKGLYRIMGNGFAGCVHFPHTAPCEVR
VLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQLEHHHHHH

Primary citation

NMR structure of the human Mediator MED25 ACID domain. Bontems, F., Verger, A., Dewitte, F. et al. J Struct Biol (2011) 174:245-251. DOI 10.1016/j.jsb.2010.10.011 · PubMed

Other PDB entries of the same protein (UniProt Q71SY5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CCV 2.53 Å, Crystal structure of human respiratory syncytial virus NS1 bound to human MED25 ACID
7EMF 3.5 Å, Human Mediator (deletion of MED1-IDR) in a Tail-extended conformation
8GXS 4.16 Å, PIC-Mediator in complex with +1 nucleosome (T40N) in H-binding state
8T9D 4.66 Å, CryoEM structure of TR-TRAP
7LBM 4.8 Å, Structure of the human Mediator-bound transcription pre-initiation complex
8GXQ 5.04 Å, PIC-Mediator in complex with +1 nucleosome (T40N) in MH-binding state
2KY6 Structure of ARC92VBD/MED25ACID
2L6U Solution NMR Structure of Med25(391-543) Comprising the Activator-Interacting Domain…
2XNF The Mediator Med25 activator interaction domain: Structure and cooperative binding of…

Browse structure collections

About this viewer

MolViewer shows 2L23 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.