2L6U: Mediator complex subunit MED25

Solution NMR Structure of Med25(391-543) Comprising the Activator-Interacting Domain (ACID) of Human Mediator Subuniti 25. Northeast Structural Genomics Consortium Target HR6188A. Determined by solution NMR. Released 12 Jan 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,310
Mol. weight: 18.64 kDa
Released: 12 Jan 2011

Explore 2L6U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L6U contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	399-409	11	1
β-strand	424-433	10	1
β-strand	447-454	8	1
α-helix	457-461	5
α-helix	463-465	3
β-strand	468-473	6	1
α-helix	481-491	11
β-strand	494-499	6	1
β-strand	510-515	6	1
β-strand	522-527	6	1
α-helix	531-540	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mediator complex subunit MED25	A	protein	163	Homo sapiens	Q71SY5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L6U_1 Mediator complex subunit MED25 (chains A)
MGHHHHHHSHGQQSVSNKLLAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLK
TEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLESLKGLYRIMGNGFAGCVHF
PHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITN

Primary citation

Solution NMR structure of MED25(391-543) comprising the activator-interacting domain (ACID) of human mediator subunit 25. Eletsky, A., Ruyechan, W.T., Xiao, R. et al. J Struct Funct Genomics (2011) 12:159-166. DOI 10.1007/s10969-011-9115-1 · PubMed

Other PDB entries of the same protein (UniProt Q71SY5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CCV 2.53 Å, Crystal structure of human respiratory syncytial virus NS1 bound to human MED25 ACID
7EMF 3.5 Å, Human Mediator (deletion of MED1-IDR) in a Tail-extended conformation
8GXS 4.16 Å, PIC-Mediator in complex with +1 nucleosome (T40N) in H-binding state
8T9D 4.66 Å, CryoEM structure of TR-TRAP
7LBM 4.8 Å, Structure of the human Mediator-bound transcription pre-initiation complex
8GXQ 5.04 Å, PIC-Mediator in complex with +1 nucleosome (T40N) in MH-binding state
2KY6 Structure of ARC92VBD/MED25ACID
2L23 NMR structure of the ACID (ACtivator Interacting Domain) of the human mediator Med25…
2XNF The Mediator Med25 activator interaction domain: Structure and cooperative binding of…

Browse structure collections

About this viewer

MolViewer shows 2L6U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.