2L7E: Domain from yeast

The structure of a domain from yeast. Determined by solution NMR. Released 23 Mar 2011.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,013
Mol. weight: 15.38 kDa
Released: 23 Mar 2011

Explore 2L7E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L7E contains 0 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	6-17	12	1
β-strand	30-37	8	1
β-strand	53-57	5	2
β-strand	66-68	3	2
β-strand	74-80	7	1
β-strand	86-90	5	2
β-strand	99-103	5	2
β-strand	110-119	10	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 14	A	protein	131	Saccharomyces cerevisiae	P35189 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L7E_1 Transcription initiation factor TFIID subunit 14 (chains A)
MVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHP
TFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQI
PLNLEHHHHHH

Primary citation

solution structure of Taf14 YEATS domain. Zhang, W., Zhang, J., Zhang, X. et al. To be published.

Other PDB entries of the same protein (UniProt P35189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UHE 1.66 Å, Taf14 ET domain in complex with C-terminal tail of Taf2
3QRL 1.7 Å, Crystal Structure of the Taf14 YEATS domain
6MIQ 1.75 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9bu
6MIO 1.85 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9pr
5D7E 1.9 Å, Crystal structure of Taf14 YEATS domain in complex with H3K9ac
6MIN 1.9 Å, Crystal structure of Taf14 YEATS domain G82A mutant in complex with histone H3K9cr
8U77 1.93 Å, Crystal structure of Taf14 in complex with Yng1
6MIP 2.0 Å, Crystal structure of Taf14 YEATS domain G82A mutant
7F4A 2.0 Å, Crystal structure of Taf14 YEATS domain in complex with H3K9bz peptide
5IOK 2.22 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9cr
9VKW 3.13 Å, Cryo-EM structure of the NuA3 complex bound to Ace-coenzyme A
9UUS 3.2 Å, The NuA3 histone acetyltransferase complex bound to acetyl-CoA and H3 tail

Browse structure collections

About this viewer

MolViewer shows 2L7E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.