2L8Y: E. coli outer membrane protein RcsF

Solution structure of the E. coli outer membrane protein RcsF (periplasmatic domain). Determined by solution NMR. Released 6 Apr 2011.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 774
Mol. weight: 11.14 kDa
Released: 6 Apr 2011

Explore 2L8Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L8Y contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	50-52	3	1
α-helix	55-59	5
β-strand	63-75	13	1
α-helix	85-97	13
β-strand	103-115	13	1
β-strand	118-131	14	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein rcsF	A	protein	105	Escherichia coli	P69411 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L8Y_1 Protein rcsF (chains A)
MAPQPKAEPAKPKAPRATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTAR
KRMQINASKMKANAVLLHSCEVTSGTPGCYRQAVCIGSALNITAK

Primary citation

A disulfide bridge network within the soluble periplasmic domain determines structure and function of the outer membrane protein RCSF. Rogov, V.V., Rogova, N.Y., Bernhard, F. et al. J Biol Chem (2011) 286:18775-18783. DOI 10.1074/jbc.M111.230185 · PubMed

Other PDB entries of the same protein (UniProt P69411 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9BIY 1.8 Å, Crystal structure of the periplasmic domain of IgaA from Escherichia coli
2Y1B 2.0 Å, Crystal structure of the E. coli outer membrane lipoprotein RcsF
7V8L 3.5 Å, LolCDE with bound RcsF in nanodiscs
6T1W 3.79 Å, Structure of E. coli BamA in complex with lipoprotein RcsF

Browse structure collections

About this viewer

MolViewer shows 2L8Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.