2Y1B: E. coli outer membrane lipoprotein RcsF

Name: PDB 2Y1B: Crystal structure of the E. coli outer membrane lipoprotein RcsF
Published: 2011-03-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Crystal structure of the E. coli outer membrane lipoprotein RcsF. Determined by X-ray diffraction at 2.0 Å resolution. Released 16 Mar 2011.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: ESCHERICHIA COLI
Chains: 1
Atoms: 703
Mol. weight: 14.42 kDa
Ligands: I3C
Released: 16 Mar 2011

Explore 2Y1B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Y1B contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	50-52	3	1
α-helix	55-58	4
β-strand	63-75	13	1
α-helix	81-83	3
α-helix	85-98	14
β-strand	103-112	10	1
β-strand	120-131	12	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Putative outer membrane protein, signal	A	protein	128	ESCHERICHIA COLI	P69411 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2Y1B_1 PUTATIVE OUTER MEMBRANE PROTEIN, SIGNAL (chains A)
MGSMLSRSPVEPVQSTAPQPKAEPAKPKAPRATPVRIYTNAEELVGKPFRDLGEVSGDSC
QASNQDSPPSIPTARKRMQINASKMKANAVLLHSCEVTSGTPGCYRQAVCIGSALNITAK
LEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
I3C	5-amino-2,4,6-triiodobenzene-1,3-dicarboxylic acid	C8 H4 I3 N O4	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Crystal Structure of the Outer Membrane Protein Rcsf, a New Substrate for the Periplasmic Protein- Disulfide Isomerase Dsbc. Leverrier, P., Declercq, J.P., Denoncin, K. et al. J Biol Chem (2011) 286:16734. DOI 10.1074/JBC.M111.224865 · PubMed

Other PDB entries of the same protein (UniProt P69411 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9BIY 1.8 Å, Crystal structure of the periplasmic domain of IgaA from Escherichia coli
7V8L 3.5 Å, LolCDE with bound RcsF in nanodiscs
6T1W 3.79 Å, Structure of E. coli BamA in complex with lipoprotein RcsF
2L8Y Solution structure of the E. coli outer membrane protein RcsF (periplasmatic domain)

Browse structure collections

About this viewer

MolViewer shows 2Y1B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.