2LA8: INAD PDZ5

Solution structure of INAD PDZ5 complexed with Kon-tiki peptide. Determined by solution NMR. Released 30 Nov 2011.

Method: Solution NMR
Organism: Drosophila melanogaster
Chains: 1
Atoms: 814
Mol. weight: 11.6 kDa
Released: 30 Nov 2011

Explore 2LA8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LA8 contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	11	1	2
β-strand	19-22	4	1
β-strand	27-31	5	1
α-helix	38-41	4
β-strand	49-53	5	1
β-strand	57	1	1
α-helix	63-71	9
β-strand	74	1	2
β-strand	77-83	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Inactivation-no-after-potential D protein,kon-tiki peptide	A	protein	106	Drosophila melanogaster	Q24008 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LA8_1 Inactivation-no-after-potential D protein,kon-tiki peptide (chains A)
LEKFNVDLMKKAGKELGLSLSPNEIGCTIADLIQGQYPEIDSKLQRGDIITKFNGDALEG
LPFQVCYALFKGANGKVSMEVTRPKPGSGGSGSLVPRLLRRNQYWV

Primary citation

The INAD scaffold is a dynamic, redox-regulated modulator of signaling in the Drosophila eye. Liu, W., Wen, W., Wei, Z. et al. Cell (2011) 145:1088-1101. DOI 10.1016/j.cell.2011.05.015 · PubMed

Other PDB entries of the same protein (UniProt Q24008 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QKV 1.55 Å, Crystal Structure of the C645S Mutant of the 5th PDZ Domain of InaD
5F67 1.76 Å, An exquisitely specific PDZ/target recognition revealed by the structure of INAD PDZ3 in…
1IHJ 1.8 Å, Crystal Structure of the N-terminal PDZ domain of InaD in complex with a NorpA…
2QKT 2.05 Å, Crystal Structure of the 5th PDZ domain of InaD
2QKU 2.2 Å, The 5th PDZ Domain of InaD in 10mM DTT
3R0H 2.6 Å, Structure of INAD PDZ45 in complex with NG2 peptide
6IRE 3.25 Å, Complex structure of INAD PDZ45 and NORPA CC-PBM

Browse structure collections

About this viewer

MolViewer shows 2LA8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.