2QKV: C645S Mutant of the 5th PDZ Domain of InaD

Crystal Structure of the C645S Mutant of the 5th PDZ Domain of InaD. Determined by X-ray diffraction at 1.55 Å resolution. Released 6 Nov 2007.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 1,547
Mol. weight: 20.64 kDa
Released: 6 Nov 2007

Explore 2QKV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QKV contains 5 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	578-581	4
β-strand	583-588	6	1
β-strand	590	1	2
β-strand	593	1	2
β-strand	597-601	5	1
β-strand	606-611	6	1
α-helix	617-622	6
β-strand	628-632	5	1
β-strand	635-636	2	1
α-helix	642-650	9
β-strand	655-661	7	1

Chain B: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	582-589	8	3
β-strand	597-602	6	3
β-strand	605-611	7	3
α-helix	617-622	6
β-strand	628-632	5	3
β-strand	635-636	2	3
α-helix	642-650	9
β-strand	654-661	8	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Inactivation-no-after-potential D protein	A, B	protein	96	Drosophila melanogaster	Q24008 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2QKV_1 Inactivation-no-after-potential D protein (chains A, B)
GIPRNSLEKFNVDLMKKAGKELGLSLSPNEIGCTIADLIQGQYPEIDSKLQRGDIITKFN
GDALEGLPFQVSYALFKGANGKVSMEVTRPKPAAAS

Primary citation

Dynamic Scaffolding in a G Protein-Coupled Signaling System. Mishra, P., Socolich, M., Wall, M.A. et al. Cell (2007) 131:80-92. DOI 10.1016/j.cell.2007.07.037 · PubMed

Other PDB entries of the same protein (UniProt Q24008 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5F67 1.76 Å, An exquisitely specific PDZ/target recognition revealed by the structure of INAD PDZ3 in…
1IHJ 1.8 Å, Crystal Structure of the N-terminal PDZ domain of InaD in complex with a NorpA…
2QKT 2.05 Å, Crystal Structure of the 5th PDZ domain of InaD
2QKU 2.2 Å, The 5th PDZ Domain of InaD in 10mM DTT
3R0H 2.6 Å, Structure of INAD PDZ45 in complex with NG2 peptide
6IRE 3.25 Å, Complex structure of INAD PDZ45 and NORPA CC-PBM
2LA8 Solution structure of INAD PDZ5 complexed with Kon-tiki peptide

Browse structure collections

About this viewer

MolViewer shows 2QKV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.