3R0H: INAD PDZ45

Structure of INAD PDZ45 in complex with NG2 peptide. Determined by X-ray diffraction at 2.6 Å resolution. Released 30 Nov 2011.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Drosophila melanogaster
Chains: 16
Atoms: 12,877
Mol. weight: 190.17 kDa
Ligands: DTV, DTT
Released: 30 Nov 2011

Explore 3R0H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R0H contains 55 α-helices and 116 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains a, b, c, d, e, f, g and h: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	3
β-strand	6-7	2	3

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	488-493	6	1
β-strand	501-504	4	1
β-strand	515-520	6	1
α-helix	525-529	5
α-helix	536	1
β-strand	537-541	5	1
β-strand	544-545	2	1
α-helix	548-550	3
α-helix	553-561	9
α-helix	563-564	2
β-strand	567-573	7	1
β-strand	580-588	9	2
α-helix	589-590	2
β-strand	597-601	5	2
β-strand	606-611	6	2
α-helix	617-622	6
β-strand	628-632	5	2
β-strand	635-636	2	2
α-helix	642-650	9
β-strand	655-663	9	2
α-helix	665-667	3

Chain B: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	487-493	7	4
β-strand	501-504	4	4
β-strand	515-520	6	4
α-helix	525-529	5
β-strand	537-541	5	4
β-strand	544-545	2	4
α-helix	548-550	3
α-helix	553-561	9
β-strand	567-573	7	4
β-strand	580-589	10	5
α-helix	590	1
β-strand	597-601	5	5
β-strand	606-611	6	5
α-helix	617-622	6
β-strand	628-632	5	5
β-strand	635-636	2	5
α-helix	642-650	9
β-strand	654-663	10	5

Chain C: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	488-493	6	7
β-strand	501-504	4	7
β-strand	515-520	6	7
α-helix	525-529	5
β-strand	537-541	5	7
β-strand	544-545	2	7
α-helix	548-550	3
α-helix	553-558	6
β-strand	567-573	7	7
β-strand	580-589	10	8
α-helix	590	1
β-strand	597-601	5	8
β-strand	606-611	6	8
α-helix	617-622	6
β-strand	628-632	5	8
β-strand	635-636	2	8
α-helix	642-651	10
β-strand	654-663	10	8
α-helix	665-667	3

Chain D: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	484	1	10
β-strand	487-493	7	11
β-strand	501-504	4	11
β-strand	516-520	5	11
α-helix	525-529	5
β-strand	537-541	5	11
β-strand	544-545	2	11
α-helix	548-550	3
α-helix	553-560	8
β-strand	567-573	7	11
β-strand	574	1	10
β-strand	580-589	10	12
β-strand	597-601	5	12
β-strand	606-611	6	12
α-helix	617-622	6
β-strand	628-632	5	12
β-strand	635-636	2	12
α-helix	642-651	10
β-strand	654-663	10	12
α-helix	665-667	3

Chain E: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	487-493	7	14
β-strand	501-504	4	14
β-strand	515-520	6	14
α-helix	525-529	5
β-strand	536-541	6	14
β-strand	544-545	2	14
α-helix	548-550	3
α-helix	553-558	6
β-strand	567-574	8	14
β-strand	580-588	9	15
α-helix	589-590	2
β-strand	597-601	5	15
β-strand	606-611	6	15
α-helix	617-622	6
β-strand	628-632	5	15
β-strand	635-636	2	15
α-helix	642-650	9
β-strand	655-663	9	15
α-helix	665-667	3

Chain F: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	487-493	7	17
β-strand	501-504	4	17
β-strand	515-520	6	17
α-helix	525-529	5
β-strand	537-541	5	17
β-strand	544-545	2	17
α-helix	548-550	3
α-helix	553-558	6
β-strand	567-573	7	17
β-strand	580-589	10	18
α-helix	590	1
β-strand	597-601	5	18
β-strand	606-611	6	18
α-helix	617-622	6
β-strand	628-632	5	18
β-strand	635-636	2	18
α-helix	642-650	9
β-strand	654-663	10	18
α-helix	665-667	3

Chain G: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	488-493	6	20
β-strand	501-504	4	20
β-strand	516-520	5	20
α-helix	525-529	5
β-strand	537-541	5	20
β-strand	544-545	2	20
α-helix	548-550	3
α-helix	553-558	6
β-strand	567-573	7	20
β-strand	580-588	9	21
β-strand	597-601	5	21
β-strand	606-611	6	21
α-helix	617-622	6
β-strand	628-632	5	21
β-strand	635-636	2	21
α-helix	642-650	9
β-strand	655-663	9	21
α-helix	665-667	3

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Inactivation-no-after-potential D protein	A, B, C, D, E, F, G, H	protein	206	Drosophila melanogaster	Q24008 (AlphaFold model)
NG2	a, b, c, d, e, f, g, h	protein	9

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>3R0H_1 Inactivation-no-after-potential D protein (chains A, B, C, D, E, F, G, H)
GPGSKPQEPATAEIKPNKKILIELKVEKKPMGVIVCGGKNNHVTTGCVITHVYPEGQVAA
DKRLKIFDHICDINGTPIHVGSMTTLKVHQLFHTTYEKAVTLTVFRADPPELEKFNVDLM
KKAGKELGLSLSPNEIGCTIADLIQGQYPEIDSKLQRGDIITKFNGDALEGLPFQVCYAL
FKGANGKVSMEVTRPKPTLRTEAPKA

Sequence of entity 2 (a, b, c, d, e, f, g, h), FASTA

>3R0H_2 NG2 (chains a, b, c, d, e, f, g, h)
ALRNGQYWV

Ligands and cofactors

ID	Name	Formula	Copies
DTV	(2S,3S)-1,4-dimercaptobutane-2,3-diol	C4 H10 O2 S2	1
DTT	2,3-dihydroxy-1,4-dithiobutane	C4 H10 O2 S2	4

Water and common crystallization additives (SO4) are not listed.

Primary citation

The INAD scaffold is a dynamic, redox-regulated modulator of signaling in the Drosophila eye. Liu, W., Wen, W., Wei, Z. et al. Cell (2011) 145:1088-1101. DOI 10.1016/j.cell.2011.05.015 · PubMed

Other PDB entries of the same protein (UniProt Q24008 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QKV 1.55 Å, Crystal Structure of the C645S Mutant of the 5th PDZ Domain of InaD
5F67 1.76 Å, An exquisitely specific PDZ/target recognition revealed by the structure of INAD PDZ3 in…
1IHJ 1.8 Å, Crystal Structure of the N-terminal PDZ domain of InaD in complex with a NorpA…
2QKT 2.05 Å, Crystal Structure of the 5th PDZ domain of InaD
2QKU 2.2 Å, The 5th PDZ Domain of InaD in 10mM DTT
6IRE 3.25 Å, Complex structure of INAD PDZ45 and NORPA CC-PBM
2LA8 Solution structure of INAD PDZ5 complexed with Kon-tiki peptide

Browse structure collections

About this viewer

MolViewer shows 3R0H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.