2LCC: RBBP1 chromobarrel domain

Solution structure of RBBP1 chromobarrel domain. Determined by solution NMR. Released 8 Feb 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 642
Mol. weight: 9.08 kDa
Released: 8 Feb 2012

Explore 2LCC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LCC contains 1 α-helix and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	11-18	8	1
β-strand	21-35	15	1
β-strand	38-45	8	1
β-strand	46	1	2
β-strand	48	1	2
β-strand	54-57	4	1
α-helix	58-60	3
β-strand	61-62	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AT-rich interactive domain-containing protein 4A	A	protein	76	Homo sapiens	P29374 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LCC_1 AT-rich interactive domain-containing protein 4A (chains A)
EDMEPCLTGTKVKVKYGRGKTQKIYEASIKSTEIDDGEVLYLVHYYGWNVRYDEWVKADR
IIWPLDKGLEHHHHHH

Primary citation

Structural insight into recognition of methylated histone tails by retinoblastoma-binding protein 1. Gong, W., Zhou, T., Mo, J. et al. J Biol Chem (2012). DOI 10.1074/jbc.M111.299149 · PubMed

Other PDB entries of the same protein (UniProt P29374 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BPH 1.85 Å, Crystal structure of the chromodomain of RBBP1
7V8N 2.05 Å, Crystal structure of the PWWP-ARID domain of ARID4A
7SMC 2.7 Å, p107 pocket domain complexed with ARID4A peptide
2MAM Solution structure of the interdigitated double Tudor domain of RBBP1
2YRV Solution structure of the RBB1NT domain of human RB(retinoblastoma)-binding protein 1
6L87 Solution structure of the tandem PWWP-ARID domains of human RBBP1

Browse structure collections

About this viewer

MolViewer shows 2LCC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.