2LKN: AH receptor-interacting protein

Solution structure of the PPIase domain of human aryl-hydrocarbon receptor-interacting protein (AIP). Determined by solution NMR. Released 17 Oct 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,306
Mol. weight: 18.68 kDa
Released: 17 Oct 2012

Explore 2LKN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LKN contains 6 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	4-9	6
β-strand	17-19	3	1
β-strand	33-37	5	1
β-strand	39-41	3	1
β-strand	49-52	4	1
β-strand	60-63	4	1
α-helix	72-77	6
β-strand	85-89	5	1
α-helix	92-95	4
α-helix	98-105	8
α-helix	108-110	3
α-helix	140-143	4
β-strand	149-158	10	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AH receptor-interacting protein	A	protein	165	Homo sapiens	O00170 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LKN_1 AH receptor-interacting protein (chains A)
ADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPME
LIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHC
CGVAQMREHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQD

Primary citation

The FKBP-Type Domain of the Human Aryl Hydrocarbon Receptor-Interacting Protein Reveals an Unusual Hsp90 Interaction. Linnert, M., Lin, Y.J., Manns, A. et al. Biochemistry (2013) 52:2097-2107. DOI 10.1021/bi301649m · PubMed

Other PDB entries of the same protein (UniProt O00170 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4APO 1.9 Å, AIP TPR domain in complex with human Tomm20 peptide
4AIF 2.01 Å, AIP TPR domain in complex with human Hsp90 peptide
8QMO 2.76 Å, Cryo-EM structure of the benzo[a]pyrene-bound Hsp90-XAP2-AHR complex
7ZUB 2.85 Å, Cryo-EM structure of the indirubin-bound Hsp90-XAP2-AHR complex

Browse structure collections

About this viewer

MolViewer shows 2LKN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.