7ZUB: Indirubin-bound Hsp90-XAP2-AHR complex

Cryo-EM structure of the indirubin-bound Hsp90-XAP2-AHR complex. Determined by electron microscopy at 2.85 Å resolution. Released 23 Nov 2022.

Method: Electron microscopy
Resolution: 2.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 14,047
Mol. weight: 257.37 kDa
Ligands: JY6, MOO, MG, ADP
Released: 23 Nov 2022

Explore 7ZUB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZUB contains 84 α-helices and 78 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	12	1	1
β-strand	15-16	2	1
β-strand	18-19	2	2
α-helix	21-30	10
α-helix	38-60	23
α-helix	62-66	5
β-strand	73-78	6	3
β-strand	83-88	6	3
α-helix	95-100	6
β-strand	104-105	2	4
α-helix	109-116	8
α-helix	118	1
α-helix	132-138	7
β-strand	140-148	9	3
β-strand	154-159	6	3
β-strand	164-169	6	3
β-strand	178-185	8	3
α-helix	187-193	7
α-helix	195-205	11
β-strand	213-218	6	3
β-strand	277-281	5	3
α-helix	288-290	3
α-helix	293-295	3
α-helix	298-309	12
β-strand	317-323	7	5
β-strand	329-335	7	5
β-strand	353-357	5	5
β-strand	360-364	5	5
α-helix	372-374	3
β-strand	378-383	6	5
α-helix	386-387	2
β-strand	388	1	6
β-strand	395	1	6
α-helix	400-421	22
α-helix	424-443	20
α-helix	448-452	5
β-strand	456-457	2	7
β-strand	458-459	2	8
β-strand	467-468	2	7
α-helix	469-474	6
β-strand	483-487	5	8
α-helix	491-495	5
α-helix	501-505	5
β-strand	510-513	4	8
α-helix	516-521	6
β-strand	527-528	2	9
β-strand	531-532	2	9
β-strand	533-535	3	8
β-strand	538	1	10
α-helix	547-570	24
β-strand	577-580	4	10
β-strand	589-593	5	10
β-strand	598	1	11
α-helix	600-607	8
α-helix	617-619	3
β-strand	621	1	11
α-helix	622-623	2
β-strand	624-628	5	10
α-helix	633-644	12
α-helix	649-665	17
α-helix	673-688	16

Chain B: 36 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	12-16	5	3
β-strand	18-19	2	4
α-helix	21-31	11
α-helix	38-57	20
α-helix	58-60	3
α-helix	62-65	4
β-strand	73-78	6	1
β-strand	83-88	6	1
α-helix	95-97	3
α-helix	98-102	5
β-strand	104-105	2	2
α-helix	109-116	8
α-helix	118	1
α-helix	132-138	7
β-strand	140-148	9	1
β-strand	154-159	6	1
β-strand	164-169	6	1
α-helix	174-175	2
β-strand	178-185	8	1
α-helix	190-193	4
α-helix	195-205	11
β-strand	213-218	6	1
β-strand	277-280	4	1
α-helix	288-290	3
α-helix	293-295	3
α-helix	298-309	12
β-strand	317-323	7	12
β-strand	329-335	7	12
β-strand	353-357	5	12
β-strand	360-364	5	12
α-helix	372-374	3
β-strand	378-383	6	12
α-helix	387	1
β-strand	388	1	13
α-helix	389	1
β-strand	395	1	13
α-helix	400-419	20
α-helix	423-443	21
α-helix	448-452	5
β-strand	456-457	2	14
β-strand	458-459	2	15
β-strand	467-468	2	14
α-helix	469-474	6
β-strand	482-487	6	15
α-helix	491-495	5
α-helix	498-500	3
α-helix	501-505	5
β-strand	510-513	4	15
α-helix	516-524	9
β-strand	527-528	2	15
β-strand	531-535	5	15
β-strand	538	1	16
α-helix	547-559	13
α-helix	561-570	10
β-strand	577-580	4	16
β-strand	589-593	5	16
β-strand	598	1	17
α-helix	600-607	8
α-helix	614-616	3
α-helix	617-620	4
β-strand	621	1	17
α-helix	622-623	2
β-strand	624-628	5	16
α-helix	633-644	12
α-helix	649-665	17
α-helix	673-688	16
α-helix	715-720	6

Chain C: 13 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
β-strand	14-19	6	18
β-strand	33-42	10	18
β-strand	49-52	4	18
β-strand	60-63	4	18
α-helix	71-78	8
β-strand	85-90	6	18
α-helix	99-102	4
α-helix	140-143	4
β-strand	148-158	11	18
β-strand	160	1	19
β-strand	163	1	19
α-helix	167-169	3
α-helix	172-192	21
α-helix	196-213	18
α-helix	221-228	8
α-helix	230-243	14
α-helix	247-260	14
α-helix	265-277	13
α-helix	281-294	14
α-helix	299-324	26

Chain D: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	272-275	4
β-strand	287-291	5	20
β-strand	297-300	4	20
α-helix	302-307	6
α-helix	312-316	5
α-helix	327-329	3
α-helix	330-343	14
β-strand	345	1	20
β-strand	349-354	6	20
β-strand	360-371	12	20
β-strand	376-385	10	20
α-helix	388-397	10
α-helix	411-414	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein HSP 90-beta	A, B	protein	730	Homo sapiens	P08238 (AlphaFold model)
AH receptor-interacting protein	C	protein	330	Homo sapiens	O00170 (AlphaFold model)
Aryl hydrocarbon receptor	D	protein	441	Homo sapiens	P35869 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7ZUB_1 Heat shock protein HSP 90-beta (chains A, B)
MHHHHHHPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKI
RYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFM
EALQAGADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEP
IGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEK
GEKEEEDKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPD
DITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIK
LYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLE
LFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVS
RMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLV
SVTKEGLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTS
TYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDL
VVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGD
EDASRMEEVD

Sequence of entity 2 (C), FASTA

>7ZUB_2 AH receptor-interacting protein (chains C)
MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPM
ELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRH
CCGVAQMREHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVP
LIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQC
KLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAP
VVSRELQALEARIRQKDEEDKARFRGIFSH

Sequence of entity 3 (D), FASTA

>7ZUB_3 Aryl hydrocarbon receptor (chains D)
APNSMNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPF
PQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGE
FLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHW
ALNPSQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLA
MNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFT
PIGCDAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTK
NNRWTWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEA
TNPFPAIMDPLPLRTKNGTSG

Ligands and cofactors

ID	Name	Formula	Copies
JY6	(3~{Z})-3-(3-oxidanylidene-1~{H}-indol-2-ylidene)-1~{H}-indol-2-one	C16 H10 N2 O2	1
MOO	Molybdate ion	Mo O4	2
MG	Magnesium ion	Mg	2
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

Cryo-EM structure of the agonist-bound Hsp90-XAP2-AHR cytosolic complex. Gruszczyk, J., Grandvuillemin, L., Lai-Kee-Him, J. et al. Nat Commun (2022) 13:7010-7010. DOI 10.1038/s41467-022-34773-w · PubMed

Other PDB entries of the same protein (UniProt P08238 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9D9I 1.5 Å, Human Hsp90b nucleotide binding domain in complex with BRI2312
6N8Y 1.55 Å, Hsp90-beta bound to PU-11-trans
5UCJ 1.69 Å, Hsp90b N-terminal domain with inhibitors
7ULJ 1.82 Å, Hsp90b N-terminal domain in complex with 42C
9D9H 1.96 Å, Human Hsp90b nucleotide binding domain in complex with BRI2311
5UC4 2.05 Å, Hsp90b N-terminal domain with inhibitors
3FWV 2.2 Å, Crystal Structure of a Redesigned TPR Protein, T-MOD(VMY), in Complex with MEEVF Peptide
3NMQ 2.2 Å, Hsp90b N-terminal domain in complex with EC44, a pyrrolo-pyrimidine methoxypyridine…
3PRY 2.28 Å, Crystal structure of the middle domain of human HSP90-beta refined at 2.3 A resolution
1UYM 2.45 Å, Human Hsp90-beta with PU3 (9-Butyl-8(3,4,5-trimethoxy-benzyl)-9H-purin-6-ylamine)
3UQ3 2.6 Å, TPR2AB-domain:pHSP90-complex of yeast Sti1
9W5I 2.63 Å, AGO maturation complex (AMC): AGO2-miRNA duplex in complex with Hsp90 beta and…

Browse structure collections

About this viewer

MolViewer shows 7ZUB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.