2LLO: Calmodulin

Solution NMR-derived structure of calmodulin N-lobe bound with ER alpha peptide. Determined by solution NMR. Released 1 Feb 2012.

Method: Solution NMR
Organisms: Xenopus laevis, Homo sapiens
Chains: 2
Atoms: 777
Mol. weight: 11.2 kDa
Ligands: CA
Released: 1 Feb 2012

Explore 2LLO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LLO contains 6 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	9-18	10
β-strand	27	1	1
α-helix	29-37	9
α-helix	45-53	9
β-strand	63	1	1
α-helix	65-71	7

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	288-291	4
α-helix	293-304	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A	protein	80	Xenopus laevis	P0DP33 (AlphaFold model)
Estrogen receptor	B	protein	19	Homo sapiens	P03372 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LLO_1 Calmodulin (chains A)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN
GTIDFPEFLTMMARKMKDTD

Sequence of entity 2 (B), FASTA

>2LLO_2 Estrogen receptor (chains B)
RAANLWPSPLMIKRSKKNS

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Structural basis for Ca2+-induced activation and dimerization of estrogen receptor alpha by calmodulin. Zhang, Y., Li, Z., Sacks, D.B. et al. J Biol Chem (2012) 287:9336-9344. DOI 10.1074/jbc.M111.334797 · PubMed

Other PDB entries of the same protein (UniProt P0DP33 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IQ5 1.8 Å, Calmodulin/nematode CA2+/Calmodulin dependent kinase kinase fragment
2COL 2.2 Å, Crystal structure analysis of CyaA/C-Cam with Pyrophosphate
4R8G 3.5 Å, Crystal Structure of Myosin-1c tail in complex with Calmodulin
1Y0V 3.6 Å, Crystal structure of anthrax edema factor (EF) in complex with calmodulin and…
1CFC Calcium-free calmodulin
1CFD Calcium-free calmodulin
1CFF NMR solution structure of a complex of calmodulin with a binding peptide of the CA2+-pump
1CKK Calmodulin/rat CA2+/CALMODULIN dependent protein kinase fragment
1DMO Calmodulin, NMR, 30 structures
1F70 Refined solution structure of calmodulin N-terminal domain
1F71 Refined solution structure of calmodulin C-terminal domain
1MUX Solution NMR structure of calmodulin/w-7 complex: the basis of diversity in molecular…

Browse structure collections

About this viewer

MolViewer shows 2LLO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.