2LNW: Guanine nucleotide exchange factor VAV2

Identification and structural basis for a novel interaction between Vav2 and Arap3. Determined by solution NMR. Released 21 Nov 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,030
Mol. weight: 15.76 kDa
Released: 21 Nov 2012

Explore 2LNW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LNW contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	674	1	1
α-helix	680-689	10
β-strand	694	1	2
β-strand	695-699	5	1
β-strand	705-712	8	1
β-strand	717-725	9	1
β-strand	728-730	3	1
β-strand	737	1	1
α-helix	740-749	10
α-helix	752-754	3
β-strand	765	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide exchange factor VAV2	A	protein	122	Homo sapiens	P52735 (AlphaFold model)
Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3	B	protein	9	Homo sapiens	Q8WWN8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LNW_1 Guanine nucleotide exchange factor VAV2 (chains A)
MGHHHHHHMSRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAI
SIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKS
RE

Sequence of entity 2 (B), FASTA

>2LNW_2 Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 (chains B)
EEPVYEEVG

Primary citation

Identification and structural basis for a novel interaction between Vav2 and Arap3. Wu, B., Wang, F., Zhang, J. et al. J Struct Biol (2012) 180:84-95. DOI 10.1016/j.jsb.2012.06.011 · PubMed

Other PDB entries of the same protein (UniProt P52735 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ROJ 1.95 Å, Crystal Structure of the VAV2 SH2 domain in complex with TXNIP phosphorylated peptide
7RNV 2.15 Å, SH2 domain of guanine nucleotide exchange factor Vav2 in complex with an actin peptide…
7WFY 2.45 Å, Crystal Structure of the VAV2 SH2 domain in complex with APP phosphorylated peptide
2DLZ Solution structure of the SH2 domain of human protein vav-2
2DM1 Solution structure of the second SH3 domain of human protein vav-2
2LNX Solution structure of Vav2 SH2 domain

Browse structure collections

About this viewer

MolViewer shows 2LNW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.