2LSY: C-terminal domain from human REV1

Structure of the C-terminal domain from human REV1. Determined by solution NMR. Released 27 Jun 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 771
Mol. weight: 11.01 kDa
Released: 27 Jun 2012

Explore 2LSY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LSY contains 4 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	1159	1	1
β-strand	1162	1	1
α-helix	1165-1178	14
α-helix	1184-1199	16
α-helix	1203-1219	17
α-helix	1224-1243	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein REV1	A	protein	95	Homo sapiens	Q9UBZ9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LSY_1 DNA repair protein REV1 (chains A)
GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRL
MQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT

Primary citation

NMR structure and dynamics of the C-terminal domain from human Rev1 and its complex with Rev1 interacting region of DNA polymerase eta. Pozhidaeva, A., Pustovalova, Y., D'Souza, S. et al. Biochemistry (2012) 51:5506-5520. DOI 10.1021/bi300566z · PubMed

Other PDB entries of the same protein (UniProt Q9UBZ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EXT 1.9 Å, Structure of polymerase-interacting domain of human Rev1 in complex with translesional…
6WS0 2.24 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
6ASR 2.36 Å, REV1 UBM2 domain complex with ubiquitin
6WS5 2.47 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
3GQC 2.5 Å, Structure of human Rev1-DNA-dNTP ternary complex
4GK0 2.7 Å, Crystal structure of human Rev3-Rev7-Rev1 complex
9VGW 2.7 Å, Crystal structure of human PCNA in complex with REV1 PIP-box
4BA9 2.73 Å, The structural basis for the coordination of Y-family Translesion DNA Polymerases by Rev1
3VU7 2.8 Å, Crystal structure of REV1-REV7-REV3 ternary complex
4GK5 3.21 Å, Crystal structure of human Rev3-Rev7-Rev1-Polkappa complex
2EBW Solution structure of the BRCT domain from human DNA repair protein REV1
2LSI Solution structure of polymerase-interacting domain of human Rev1 in complex with…

Browse structure collections

About this viewer

MolViewer shows 2LSY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.