2LYH: Faap24 residues 141-215

Structure of Faap24 residues 141-215. Determined by solution NMR. Released 1 May 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 576
Mol. weight: 10.75 kDa
Released: 1 May 2013

Explore 2LYH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LYH contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	160-163	4
α-helix	174-177	4
α-helix	184-188	5
α-helix	192-198	7
α-helix	201-212	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fanconi anemia-associated protein of 24 kDa	A	protein	98	Homo sapiens	Q9BTP7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LYH_1 Fanconi anemia-associated protein of 24 kDa (chains A)
MGSSHHHHHHSSHMLVPRGSLEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLL
LQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR

Primary citation

The Fanconi anemia associated protein FAAP24 uses two substrate specific binding surfaces for DNA recognition. Wienk, H., Slootweg, J.C., Speerstra, S. et al. Nucleic Acids Res (2013) 41:6739-6749. DOI 10.1093/nar/gkt354 · PubMed

Other PDB entries of the same protein (UniProt Q9BTP7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BXO 2.15 Å, Architecture and DNA recognition elements of the Fanconi anemia FANCM- FAAP24 complex
9HJO 2.4 Å, FANCM-FAAP24-dsDNA complex
4M6W 2.9 Å, Crystal structure of the C-terminal segment of FANCM in complex with FAAP24
2M9M Solution Structure of ERCC4 domain of human FAAP24
2M9N Solution Structure of (HhH)2 domain of human FAAP24

Browse structure collections

About this viewer

MolViewer shows 2LYH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.