2M9N: (HhH)2 domain of human FAAP24

Solution Structure of (HhH)2 domain of human FAAP24. Determined by solution NMR. Released 18 Sept 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 468
Mol. weight: 6.77 kDa
Released: 18 Sept 2013

Explore 2M9N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M9N contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	159-163	5
α-helix	174-178	5
α-helix	184-187	4
α-helix	192-196	5
α-helix	201-210	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fanconi anemia-associated protein of 24 kDa	A	protein	63	Homo sapiens	Q9BTP7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M9N_1 Fanconi anemia-associated protein of 24 kDa (chains A)
GSSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFT
QPR

Primary citation

Structure analysis of FAAP24 reveals single-stranded DNA-binding activity and domain functions in DNA damage response. Wang, Y., Han, X., Wu, F. et al. Cell Res (2013) 23:1215-1228. DOI 10.1038/cr.2013.124 · PubMed

Other PDB entries of the same protein (UniProt Q9BTP7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BXO 2.15 Å, Architecture and DNA recognition elements of the Fanconi anemia FANCM- FAAP24 complex
9HJO 2.4 Å, FANCM-FAAP24-dsDNA complex
4M6W 2.9 Å, Crystal structure of the C-terminal segment of FANCM in complex with FAAP24
2LYH Structure of Faap24 residues 141-215
2M9M Solution Structure of ERCC4 domain of human FAAP24

Browse structure collections

About this viewer

MolViewer shows 2M9N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.