2M4G: Murine Norovirus VPg protein

Solution structure of the Core Domain (11-85) of the Murine Norovirus VPg protein. Determined by solution NMR. Released 27 Mar 2013.

Method: Solution NMR
Organism: Murine norovirus 1
Chains: 1
Atoms: 625
Mol. weight: 8.88 kDa
Released: 27 Mar 2013

Explore 2M4G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M4G contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	23-35	13
α-helix	42-52	11
α-helix	70-72	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Murine Norovirus VPg protein	A	protein	75	Murine norovirus 1	Q80J95 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M4G_1 Murine Norovirus VPg protein (chains A)
GRPGVFRTRGLTDEEYDEFKKRRESRGGKYSIDDYLADREREEELLERDEEEAIFGDGFG
LKATRRSRKAERAKL

Primary citation

Structures of the Compact Helical Core Domains of Feline Calicivirus and Murine Norovirus VPg Proteins. Leen, E.N., Kwok, K.Y., Birtley, J.R. et al. J Virol (2013) 87:5318-5330. DOI 10.1128/JVI.03151-12 · PubMed

Other PDB entries of the same protein (UniProt Q80J95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ASH 1.58 Å, Crystal structure of the NS6 protease from murine norovirus 1
3UQS 2.0 Å, Crystal structures of murine norovirus RNA-dependent RNA polymerase
3SFG 2.21 Å, crystal structure of murine norovirus RNA dependent RNA polymerase in complex with…
4NRU 2.3 Å, Murine Norovirus RNA-dependent-RNA-polymerase in complex with Compound 6, a suramin…
4X2V 2.3 Å, Crystal structure of the Murine Norovirus NS6 protease (inactive C139A mutant) with a…
8A8X 2.37 Å, TRIM7 PRYSPRY in complex with a MNV1-NS3 peptide HDDFGLQ
4O4R 2.4 Å, Murine Norovirus RdRp in complex with PPNDS
4X2Y 2.42 Å, Crystal structure of a chimeric Murine Norovirus NS6 protease (inactive C139A mutant) in…
3UR0 2.45 Å, Crystal structures of murine norovirus RNA-dependent RNA polymerase in complex with…
4X2X 2.47 Å, Crystal structure of the Murine Norovirus NS6 protease (inactive C139A mutant) with a…
3QID 2.5 Å, Crystal structures and functional analysis of murine norovirus RNA-dependent RNA…
3SFU 2.5 Å, crystal structure of murine norovirus RNA dependent RNA polymerase in complex with…

Browse structure collections

About this viewer

MolViewer shows 2M4G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.