2M9Y: Catalytic Domain of HHARI

Name: PDB 2M9Y: Solution Structure of the Catalytic Domain of HHARI
Published: 2013-11-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Solution Structure of the Catalytic Domain of HHARI. Determined by solution NMR. Released 13 Nov 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 588
Mol. weight: 8.57 kDa
Ligands: ZN
Released: 13 Nov 2013

Explore 2M9Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M9Y contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	337-340	4
β-strand	343	1	1
β-strand	350	1	1
β-strand	359-361	3	2
β-strand	370-372	3	2
β-strand	377-378	2	2
α-helix	379-382	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase ARIH1	A	protein	74	Homo sapiens	Q9Y4X5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M9Y_1 E3 ubiquitin-protein ligase ARIH1 (chains A)
GSKKCDDDSETSNWIAANTKECPKCHVTIEKDGGSNHMVCRNQNCKAEFCWVCLGPWEPH
GSAWYNCNRYNEDD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structure of the HHARI catalytic domain shows glimpses of a HECT E3 ligase. Spratt, D.E., Mercier, P., Shaw, G.S. PLoS One (2013) 8:e74047-e74047. DOI 10.1371/journal.pone.0074047 · PubMed

Other PDB entries of the same protein (UniProt Q9Y4X5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UDH 3.24 Å, HHARI/ARIH1-UBCH7~Ubiquitin
4KBL 3.3 Å, Structure of HHARI, a RING-IBR-RING ubiquitin ligase: autoinhibition of an…
5TTE 3.5 Å, Crystal Structure of an RBR E3 ubiquitin ligase in complex with an E2-Ub thioester…
7B5N 3.6 Å, Ubiquitin ligation to F-box protein substrates by SCF-RBR E3-E3 super-assembly:…
7B5S 3.6 Å, Ubiquitin ligation to F-box protein substrates by SCF-RBR E3-E3 super-assembly:…
4KC9 3.6 Å, Structure of HHARI, a RING-IBR-RING ubiquitin ligase: autoinhibition of an…
7B5L 3.8 Å, Ubiquitin ligation to F-box protein substrates by SCF-RBR E3-E3 super-assembly:…
7B5M 3.91 Å, Ubiquitin ligation to F-box protein substrates by SCF-RBR E3-E3 super-assembly:…
1WD2 Solution Structure of the C-terminal RING from a RING-IBR-RING (TRIAD) motif

Browse structure collections

About this viewer

MolViewer shows 2M9Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.