Backbone 1H, 13C, and 15N Chemical Shift Assignments for murine norovirus NS1/2 D94E mutant. Determined by solution NMR. Released 18 Dec 2013.
Explore 2MCD in 3D Show helices and sheets RCSB PDB PDBe
2MCD contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 63 | 1 | 1 |
| β-strand | 64 | 1 | 2 |
| α-helix | 67-69 | 3 | |
| β-strand | 70 | 1 | 2 |
| β-strand | 73 | 1 | 1 |
| α-helix | 76-93 | 18 | |
| α-helix | 103-109 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Murine norovirus 1 | A | protein | 98 | Murine norovirus 1 | Q80J95 (AlphaFold model) |
>2MCD_1 Murine norovirus 1 (chains A) MRGSHHHHHHGSVSFGAPSPLSSESEDEINYMTPPEQEAQPGALAALHAEGPLAGLPVTR SDARVLIFNEWEERKKSEPWLRLDMSDKAIFRRYPHLR
Murine norovirus protein NS1/2 aspartate to glutamate mutation, sufficient for persistence, reorients side chain of surface exposed tryptophan within a novel structured domain. Borin, B.N., Tang, W., Nice, T.J. et al. Proteins (2014) 82:1200-1209. DOI 10.1002/prot.24484 · PubMed
Other PDB entries of the same protein (UniProt Q80J95 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2MCD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.