2MEM: SLED domain of Scml2

Solution NMR structure of SLED domain of Scml2. Determined by solution NMR. Released 23 Apr 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 920
Mol. weight: 13.11 kDa
Released: 23 Apr 2014

Explore 2MEM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MEM contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	356-359	4	1
β-strand	371	1	2
α-helix	373-378	6
β-strand	383-387	5	1
α-helix	388-402	15
β-strand	403	1	2
α-helix	406-409	4
β-strand	422-427	6	3
β-strand	430-435	6	3
α-helix	442-455	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sex comb on midleg-like protein 2	A	protein	119	Homo sapiens	Q9UQR0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MEM_1 Sex comb on midleg-like protein 2 (chains A)
GSHMMSTVCVYVNKHGNFGPHLDPKRIQQLPDHFGPGPVNVVLRRIVQACVDCALETKTV
FGYLKPDNRGGEVITASFDGETHSIQLPPVNSASFALRFLENFCHSLQCDNLLSSQPFS

Primary citation

Solution NMR Structure of the DNA-binding Domain from Scml2 (Sex Comb on Midleg-like 2). Bezsonova, I. J Biol Chem (2014) 289:15739-15749. DOI 10.1074/jbc.M113.524009 · PubMed

Other PDB entries of the same protein (UniProt Q9UQR0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BIV 1.7 Å, Crystal structure of the wild-type MBT domains of Human SCML2
1OI1 1.78 Å, Crystal Structure of the MBT domains of Human SCML2
2VYT 1.9 Å, The MBT repeats of human SCML2 bind to peptides containing mono methylated lysine.
4EDU 2.58 Å, The MBT repeats of human SCML2 in a complex with histone H2A peptide

Browse structure collections

About this viewer

MolViewer shows 2MEM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.