2MH0: P300 Taz2:ETAD1 complex

Solution NMR structure of the p300 Taz2:ETAD1 complex. Determined by solution NMR. Released 12 Nov 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 994
Mol. weight: 14.38 kDa
Released: 12 Nov 2014

Explore 2MH0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MH0 contains 5 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	12-25	14

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	1727-1747	21
α-helix	1756-1769	14
α-helix	1780-1795	16
α-helix	1804-1810	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor E2-alpha	A	protein	39	Homo sapiens	P15923 (AlphaFold model)
Histone acetyltransferase p300	B	protein	92	Homo sapiens	Q09472 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MH0_1 Transcription factor E2-alpha (chains A)
GSMNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRP

Sequence of entity 2 (B), FASTA

>2MH0_2 Histone acetyltransferase p300 (chains B)
GSATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCP
ICKQLIALAAYHAKHCQENKCPVPFCLNIKQK

Primary citation

Structural insights into TAZ2 domain-mediated CBP/p300 recruitment by transactivation domain 1 of the lymphopoietic transcription factor E2A. Lochhead, M.R., Brown, A.D., Kirlin, A.C. et al. J Biol Chem (2020) 295:4303-4315. DOI 10.1074/jbc.RA119.011078 · PubMed

Other PDB entries of the same protein (UniProt P15923 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U5V 1.7 Å, Crystal structure of Max-E47
6MGN 1.9 Å, mouse Id1 (51-104) - human hE47 (348-399) complex
2YPA 2.8 Å, Structure of the SCL:E47:LMO2:LDB1 complex bound to DNA
2YPB 2.87 Å, Structure of the SCL:E47 complex bound to DNA

Browse structure collections

About this viewer

MolViewer shows 2MH0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.