3U5V: Max-E47

Crystal structure of Max-E47. Determined by X-ray diffraction at 1.7 Å resolution. Released 21 Mar 2012.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: Mus musculus, Homo sapiens
Chains: 1
Atoms: 548
Mol. weight: 9.2 kDa
Released: 21 Mar 2012

Explore 3U5V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3U5V contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	9-33	25
α-helix	37-39	3
α-helix	41-61	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein max, Transcription factor E2-alpha chimera	A	protein	76	Mus musculus, Homo sapiens	P15923 (AlphaFold model), P28574 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3U5V_1 Protein max, Transcription factor E2-alpha chimera (chains A)
MGADKRAHHNALERKRRRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVILGLEQQ
VRERNLNPLNHHHHHH

Primary citation

Crystal structure of the minimalist max-e47 protein chimera. Ahmadpour, F., Ghirlando, R., De Jong, A.T. et al. PLoS One (2012) 7:e32136-e32136. DOI 10.1371/journal.pone.0032136 · PubMed

Other PDB entries of the same protein (UniProt P15923 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MGN 1.9 Å, mouse Id1 (51-104) - human hE47 (348-399) complex
2YPA 2.8 Å, Structure of the SCL:E47:LMO2:LDB1 complex bound to DNA
2YPB 2.87 Å, Structure of the SCL:E47 complex bound to DNA
2MH0 Solution NMR structure of the p300 Taz2:ETAD1 complex

Browse structure collections

About this viewer

MolViewer shows 3U5V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.