2MQS: Matrix metalloproteinase-14

Transient Collagen Triple Helix Binding to a Key Metalloproteinase in Invasion and Development: Spin Labels to Structure. Determined by solution NMR. Released 11 Feb 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 4
Atoms: 2,315
Mol. weight: 32.74 kDa
Released: 11 Feb 2015

Explore 2MQS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MQS contains 16 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	318-320	3
β-strand	325-329	5	1
β-strand	332-337	6	1
β-strand	340-345	6	1
β-strand	348-349	2	1
α-helix	350	1
β-strand	355-356	2	1
α-helix	357-360	4
β-strand	370-373	4	2
β-strand	379-383	5	2
β-strand	386-391	6	2
β-strand	394-395	2	2
α-helix	396	1
β-strand	401-402	2	2
α-helix	403-406	4
β-strand	408	1	3
β-strand	417-421	5	3
β-strand	426-431	6	3
β-strand	434-439	6	3
β-strand	444-445	2	3
α-helix	446	1
β-strand	451-452	2	3
α-helix	453-455	3
β-strand	457	1	4
α-helix	459-460	2
β-strand	466-468	3	4
β-strand	474-479	6	4
β-strand	482-487	6	4
β-strand	492-493	2	4
α-helix	494	1
β-strand	499-500	2	4
α-helix	501	1
α-helix	502-506	5

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1-5	5
α-helix	10-34	25

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	101-105	5
α-helix	107-133	27

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	207-231	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Matrix metalloproteinase-14	A	protein	196	Homo sapiens	P50281 (AlphaFold model)
THP_L_and_M_chain	B, C	protein	36
THP_T_chain	D	protein	33

Sequence of entity 1 (A), FASTA

>2MQS_1 Matrix metalloproteinase-14 (chains A)
PNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERK
DGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKY
YRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEP
GYPKSALRDWMGCPSG

Sequence of entity 2 (B, C), FASTA

>2MQS_2 THP_L_and_M_chain (chains B, C)
GPPGPPGPPGPQGIAGQRGVVGLPGPPGPPGPPGPP

Sequence of entity 3 (D), FASTA

>2MQS_3 THP_T_chain (chains D)
GPPGPPGPPGPQGIAGQRGVVGLPGPPGPPGPP

Primary citation

Transient collagen triple helix binding to a key metalloproteinase in invasion and development. Zhao, Y., Marcink, T.C., Sanganna Gari, R.R. et al. Structure (2015) 23:257-269. DOI 10.1016/j.str.2014.11.021 · PubMed

Other PDB entries of the same protein (UniProt P50281 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3C7X 1.7 Å, Hemopexin-like domain of matrix metalloproteinase 14
4P3C 1.94 Å, MT1-MMP:Fab complex (Form I)
4P3D 1.95 Å, MT1-MMP:Fab complex (Form II)
3MA2 2.05 Å, Complex membrane type-1 matrix metalloproteinase (MT1-MMP) with tissue inhibitor of…
5H0U 2.24 Å, Crystal structure of the catalytic domain of membrane type 1 matrix metalloproteinase
4QXU 2.3 Å, Novel Inhibition Mechanism of Membrane Metalloprotease by an Exosite-Swiveling…
3X23 2.4 Å, Radixin complex
1BQQ 2.75 Å, Crystal structure of the MT1-mmp--timp-2 complex
1BUV 2.75 Å, Crystal structure of the MT1-mmp-timp-2 complex
6CLZ MT1-MMP HPX domain with Blade 4 Loop Bound to Nanodiscs
6CM1 MT1-MMP HPX Domain with Blade 2 Loop Bound to Nanodiscs

Browse structure collections

About this viewer

MolViewer shows 2MQS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.