6CLZ: MT1-MMP HPX domain with Blade 4 Loop

MT1-MMP HPX domain with Blade 4 Loop Bound to Nanodiscs. Determined by solution NMR. Released 12 Dec 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 3
Atoms: 15,173
Mol. weight: 221.02 kDa
Ligands: PX4
Released: 12 Dec 2018

Explore 6CLZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6CLZ contains 15 α-helices and 22 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	318-320	3
β-strand	325-329	5	1
β-strand	332-337	6	1
β-strand	340-345	6	1
β-strand	348-349	2	1
α-helix	350	1
β-strand	355-356	2	1
α-helix	357-360	4
α-helix	364-365	2
β-strand	370-373	4	2
β-strand	379-383	5	2
β-strand	386-391	6	2
β-strand	394-395	2	2
β-strand	401-402	2	2
α-helix	403-406	4
β-strand	408	1	3
β-strand	417-421	5	4
β-strand	426-431	6	4
β-strand	434-437	4	4
β-strand	438-439	2	3
β-strand	444-445	2	3
β-strand	451-452	2	4
α-helix	453-455	3
β-strand	465-468	4	1
β-strand	474-479	6	1
β-strand	482-487	6	1
β-strand	492-493	2	1
β-strand	499-500	2	1
α-helix	501-504	4

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	56-144	89
α-helix	146-262	117

Chain C: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	56-103	48
α-helix	106-184	79
α-helix	186-205	20
α-helix	207-229	23
α-helix	230-232	3
α-helix	233-262	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Matrix metalloproteinase-14	A	protein	196	Homo sapiens	P50281 (AlphaFold model)
Apolipoprotein A-I	B, C	protein	211	Homo sapiens	P02647 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6CLZ_1 Matrix metalloproteinase-14 (chains A)
PNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERK
DGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKY
YRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEP
GYPKSALRDWMGCPSG

Sequence of entity 2 (B, C), FASTA

>6CLZ_2 Apolipoprotein A-I (chains B, C)
STFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMEL
YRQKVEPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRA
RAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALE
DLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Ligands and cofactors

ID	Name	Formula	Copies
PX4	1,2-dimyristoyl-sn-glycero-3-phosphocholine	C36 H73 N O8 P	218

Water and common crystallization additives (NA, CL) are not listed.

Primary citation

MT1-MMP Binds Membranes by Opposite Tips of Its beta Propeller to Position It for Pericellular Proteolysis. Marcink, T.C., Simoncic, J.A., An, B. et al. Structure (2019) 27:281-292.e6. DOI 10.1016/j.str.2018.10.008 · PubMed

Other PDB entries of the same protein (UniProt P50281 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3C7X 1.7 Å, Hemopexin-like domain of matrix metalloproteinase 14
4P3C 1.94 Å, MT1-MMP:Fab complex (Form I)
4P3D 1.95 Å, MT1-MMP:Fab complex (Form II)
3MA2 2.05 Å, Complex membrane type-1 matrix metalloproteinase (MT1-MMP) with tissue inhibitor of…
5H0U 2.24 Å, Crystal structure of the catalytic domain of membrane type 1 matrix metalloproteinase
4QXU 2.3 Å, Novel Inhibition Mechanism of Membrane Metalloprotease by an Exosite-Swiveling…
3X23 2.4 Å, Radixin complex
1BQQ 2.75 Å, Crystal structure of the MT1-mmp--timp-2 complex
1BUV 2.75 Å, Crystal structure of the MT1-mmp-timp-2 complex
2MQS Transient Collagen Triple Helix Binding to a Key Metalloproteinase in Invasion and…
6CM1 MT1-MMP HPX Domain with Blade 2 Loop Bound to Nanodiscs

Browse structure collections

About this viewer

MolViewer shows 6CLZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.