4P3C: MT1-MMP:Fab complex

MT1-MMP:Fab complex (Form I). Determined by X-ray diffraction at 1.94 Å resolution. Released 17 Dec 2014.

Method: X-ray diffraction
Resolution: 1.94 Å
Organisms: Mus musculus, Homo sapiens
Chains: 3
Atoms: 3,992
Mol. weight: 49.87 kDa
Ligands: MG
Released: 17 Dec 2014

Explore 4P3C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P3C contains 16 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	11-12	2	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	3
β-strand	45-51	7	3
β-strand	58-60	3	3
α-helix	62-64	3
β-strand	68-73	6	1
α-helix	74-76	3
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-100	9	3
β-strand	103-108	6	3
β-strand	112-114	3	3
β-strand	115-116	2	2
α-helix	120-121	2
β-strand	122	1	4
α-helix	123-124	2
β-strand	125-129	5	5
β-strand	140-150	11	5
β-strand	151	1	4
β-strand	156-159	4	6
α-helix	160-162	3
β-strand	164	1	6
β-strand	168-170	3	5
α-helix	171-173	3
β-strand	174-176	3	5
β-strand	179-189	11	5
α-helix	190-192	3
β-strand	199-204	6	6
α-helix	205-207	3
β-strand	209-214	6	6

Chain L: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-13	4	8
β-strand	19-25	7	7
β-strand	30	1	9
β-strand	36	1	9
β-strand	38-43	6	8
β-strand	49-54	6	8
β-strand	58-59	2	8
α-helix	60	1
β-strand	67-72	6	7
β-strand	75-80	6	7
α-helix	85-87	3
β-strand	89-95	7	8
α-helix	101	1
β-strand	102-103	2	8
β-strand	107-111	5	8
β-strand	117	1	10
β-strand	120-124	5	11
α-helix	125-127	3
α-helix	128-132	5
β-strand	135-145	11	11
β-strand	146	1	10
β-strand	150-156	7	12
β-strand	159-161	3	12
β-strand	165-170	6	11
β-strand	173	1	13
β-strand	176	1	13
β-strand	179-188	10	11
α-helix	189-192	4
β-strand	197-204	8	12
β-strand	211-216	6	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heavy Chain Fab fragment of antibody LEM-2/15	H	protein	218	Mus musculus
Light Chain Fab fragment of antibody LEM-2/15	L	protein	218	Mus musculus
Matrix metalloproteinase-14	M	protein	13	Homo sapiens	P50281 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>4P3C_1 Heavy Chain Fab fragment of antibody LEM-2/15 (chains H)
EVKLVESGGGLVKPGGSLKLSCAASGFIFSNYAMSWVRQTPEKRLEWVATISGGGRNIYS
LDSVKGRFTFFRDNARNTLYLQMSSLRSEDTAMYFCSRENYGSSFTYWGQGTLVTVSSAK
TTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLY
TLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR

Sequence of entity 2 (L), FASTA

>4P3C_2 Light Chain Fab fragment of antibody LEM-2/15 (chains L)
DVLMTQTPLSLPVGLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHAPYTFGGGTKLEIKRAADAAPT
VSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYS
MSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN

Sequence of entity 3 (M), FASTA

>4P3C_3 Matrix metalloproteinase-14 (chains M)
FDSAEPWTVRNED

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (ACT, EDO, EPE, CL) are not listed.

Primary citation

Inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody. Udi, Y., Grossman, M., Solomonov, I. et al. Structure (2015) 23:104-115. DOI 10.1016/j.str.2014.10.012 · PubMed

Other PDB entries of the same protein (UniProt P50281 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3C7X 1.7 Å, Hemopexin-like domain of matrix metalloproteinase 14
4P3D 1.95 Å, MT1-MMP:Fab complex (Form II)
3MA2 2.05 Å, Complex membrane type-1 matrix metalloproteinase (MT1-MMP) with tissue inhibitor of…
5H0U 2.24 Å, Crystal structure of the catalytic domain of membrane type 1 matrix metalloproteinase
4QXU 2.3 Å, Novel Inhibition Mechanism of Membrane Metalloprotease by an Exosite-Swiveling…
3X23 2.4 Å, Radixin complex
1BQQ 2.75 Å, Crystal structure of the MT1-mmp--timp-2 complex
1BUV 2.75 Å, Crystal structure of the MT1-mmp-timp-2 complex
2MQS Transient Collagen Triple Helix Binding to a Key Metalloproteinase in Invasion and…
6CLZ MT1-MMP HPX domain with Blade 4 Loop Bound to Nanodiscs
6CM1 MT1-MMP HPX Domain with Blade 2 Loop Bound to Nanodiscs

Browse structure collections

About this viewer

MolViewer shows 4P3C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.