2MS7: Mitochondrial antiviral-signaling protein

High-resolution solid-state NMR structure of the helical signal transduction filament MAVS CARD. Determined by solid-state NMR. Released 2 Sept 2015.

Method: Solid-state NMR
Organism: Homo sapiens
Chains: 21
Atoms: 17,430
Mol. weight: 248.16 kDa
Released: 2 Sept 2015

Explore 2MS7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MS7 contains 147 α-helices and 0 β-strands across 21 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T and U: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	3-14	12
α-helix	16-19	4
α-helix	24-26	3
α-helix	36-48	13
α-helix	51-61	11
α-helix	69-78	10
α-helix	82-93	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitochondrial antiviral-signaling protein	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U	protein	102	Homo sapiens	Q7Z434 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U), FASTA

>2MS7_1 Mitochondrial antiviral-signaling protein (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U)
GSMPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHL
FNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTS

Primary citation

Structure determination of helical filaments by solid-state NMR spectroscopy. He, L., Bardiaux, B., Ahmed, M. et al. Proc Natl Acad Sci U S A (2016) 113:E272-E281. DOI 10.1073/pnas.1513119113 · PubMed

Other PDB entries of the same protein (UniProt Q7Z434 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RC5 1.6 Å, Molecular mechanisms of viral and host-cell substrate recognition by HCV NS3/4A protease
2VGQ 2.1 Å, Crystal Structure of Human IPS-1 CARD
5JEK 2.4 Å, Phosphorylated MAVS in complex with IRF-3
4Z8M 2.95 Å, Crystal structure of the MAVS-TRAF6 complex
7DNI 3.2 Å, MDA5 CARDs-MAVS CARD polyUb complex
8WKW 3.21 Å, Structure of MAVS-CARD Filament
4P4H 3.4 Å, Caught-in-action signaling complex of RIG-I 2CARD domain and MAVS CARD domain
3J6J 3.64 Å, 3.6 Angstrom resolution MAVS filament generated from helical reconstruction
3J6C 9.6 Å, Cryo-EM structure of MAVS CARD filament
2MS8 Solution NMR structure of MAVS CARD

Browse structure collections

About this viewer

MolViewer shows 2MS7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.