3J6C: MAVS CARD filament

Cryo-EM structure of MAVS CARD filament. Determined by electron microscopy at 9.6 Å resolution. Released 5 Mar 2014.

Method: Electron microscopy
Resolution: 9.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 779
Mol. weight: 10.83 kDa
Released: 5 Mar 2014

Explore 3J6C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3J6C contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	371-383	13
α-helix	385-388	4
α-helix	393-396	4
α-helix	397-399	3
α-helix	405-418	14
α-helix	420-431	12
α-helix	438-447	10
α-helix	451-461	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitochondrial antiviral-signaling protein	A	protein	93	Homo sapiens	Q7Z434 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3J6C_1 Mitochondrial antiviral-signaling protein (chains A)
MAFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFN
TLQRRPGWVEYFIAALRGCELVDLADEVASVYQ

Primary citation

Structural basis for the prion-like MAVS filaments in antiviral innate immunity. Xu, H., He, X., Zheng, H. et al. Elife (2014) 3:e01489-e01489. DOI 10.7554/eLife.01489 · PubMed

Other PDB entries of the same protein (UniProt Q7Z434 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RC5 1.6 Å, Molecular mechanisms of viral and host-cell substrate recognition by HCV NS3/4A protease
2VGQ 2.1 Å, Crystal Structure of Human IPS-1 CARD
5JEK 2.4 Å, Phosphorylated MAVS in complex with IRF-3
4Z8M 2.95 Å, Crystal structure of the MAVS-TRAF6 complex
7DNI 3.2 Å, MDA5 CARDs-MAVS CARD polyUb complex
8WKW 3.21 Å, Structure of MAVS-CARD Filament
4P4H 3.4 Å, Caught-in-action signaling complex of RIG-I 2CARD domain and MAVS CARD domain
3J6J 3.64 Å, 3.6 Angstrom resolution MAVS filament generated from helical reconstruction
2MS7 High-resolution solid-state NMR structure of the helical signal transduction filament…
2MS8 Solution NMR structure of MAVS CARD

Browse structure collections

About this viewer

MolViewer shows 3J6C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.