2MS8: MAVS CARD

Solution NMR structure of MAVS CARD. Determined by solution NMR. Released 2 Sept 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 830
Mol. weight: 11.82 kDa
Released: 2 Sept 2015

Explore 2MS8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MS8 contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	4-13	10
α-helix	16-19	4
α-helix	24-27	4
α-helix	28-30	3
α-helix	36-48	13
α-helix	52-62	11
α-helix	68-78	11
α-helix	82-92	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitochondrial antiviral-signaling protein	A	protein	102	Homo sapiens	Q7Z434 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MS8_1 Mitochondrial antiviral-signaling protein (chains A)
GSMPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHL
FNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTS

Primary citation

Structure determination of helical filaments by solid-state NMR spectroscopy. He, L., Bardiaux, B., Ahmed, M. et al. Proc Natl Acad Sci U S A (2016) 113:E272-E281. DOI 10.1073/pnas.1513119113 · PubMed

Other PDB entries of the same protein (UniProt Q7Z434 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RC5 1.6 Å, Molecular mechanisms of viral and host-cell substrate recognition by HCV NS3/4A protease
2VGQ 2.1 Å, Crystal Structure of Human IPS-1 CARD
5JEK 2.4 Å, Phosphorylated MAVS in complex with IRF-3
4Z8M 2.95 Å, Crystal structure of the MAVS-TRAF6 complex
7DNI 3.2 Å, MDA5 CARDs-MAVS CARD polyUb complex
8WKW 3.21 Å, Structure of MAVS-CARD Filament
4P4H 3.4 Å, Caught-in-action signaling complex of RIG-I 2CARD domain and MAVS CARD domain
3J6J 3.64 Å, 3.6 Angstrom resolution MAVS filament generated from helical reconstruction
3J6C 9.6 Å, Cryo-EM structure of MAVS CARD filament
2MS7 High-resolution solid-state NMR structure of the helical signal transduction filament…

Browse structure collections

About this viewer

MolViewer shows 2MS8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.