3J6J: Mitochondrial antiviral-signaling protein

3.6 Angstrom resolution MAVS filament generated from helical reconstruction. Determined by electron microscopy at 3.64 Å resolution. Released 30 Jul 2014.

Method: Electron microscopy
Resolution: 3.64 Å
Organism: Homo sapiens
Chains: 8
Atoms: 6,344
Mol. weight: 90.41 kDa
Released: 30 Jul 2014

Explore 3J6J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3J6J contains 63 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	2-14	13
α-helix	16-19	4
α-helix	24-27	4
α-helix	28-30	3
α-helix	38-49	12
α-helix	51-62	12
α-helix	68-78	11
α-helix	82-93	12

Chains B, C, D, E, G and I: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	2-14	13
α-helix	16-19	4
α-helix	24-27	4
α-helix	28-30	3
α-helix	36-49	14
α-helix	51-62	12
α-helix	68-78	11
α-helix	82-93	12

Chain L: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	2-14	13
α-helix	16-19	4
α-helix	24-27	4
α-helix	36-49	14
α-helix	51-62	12
α-helix	68-78	11
α-helix	82-93	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitochondrial antiviral-signaling protein	A, B, C, D, E, G, I, L	protein	97	Homo sapiens	Q7Z434 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, G, I, L), FASTA

>3J6J_1 Mitochondrial antiviral-signaling protein (chains A, B, C, D, E, G, I, L)
MAFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFN
TLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQP

Primary citation

Molecular Imprinting as a Signal-Activation Mechanism of the Viral RNA Sensor RIG-I. Wu, B., Peisley, A., Tetrault, D. et al. Mol Cell (2014) 55:511-523. DOI 10.1016/j.molcel.2014.06.010 · PubMed

Other PDB entries of the same protein (UniProt Q7Z434 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RC5 1.6 Å, Molecular mechanisms of viral and host-cell substrate recognition by HCV NS3/4A protease
2VGQ 2.1 Å, Crystal Structure of Human IPS-1 CARD
5JEK 2.4 Å, Phosphorylated MAVS in complex with IRF-3
4Z8M 2.95 Å, Crystal structure of the MAVS-TRAF6 complex
7DNI 3.2 Å, MDA5 CARDs-MAVS CARD polyUb complex
8WKW 3.21 Å, Structure of MAVS-CARD Filament
4P4H 3.4 Å, Caught-in-action signaling complex of RIG-I 2CARD domain and MAVS CARD domain
3J6C 9.6 Å, Cryo-EM structure of MAVS CARD filament
2MS7 High-resolution solid-state NMR structure of the helical signal transduction filament…
2MS8 Solution NMR structure of MAVS CARD

Browse structure collections

About this viewer

MolViewer shows 3J6J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.