2MUQ: Human FAAP20 UBZ

Solution Structure of the Human FAAP20 UBZ. Determined by solution NMR. Released 3 Dec 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 336
Mol. weight: 4.92 kDa
Ligands: ZN
Released: 3 Dec 2014

Explore 2MUQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MUQ contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	1
β-strand	16-17	2	1
α-helix	24-37	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fanconi anemia-associated protein of 20 kDa	A	protein	44	Homo sapiens	Q6NZ36 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MUQ_1 Fanconi anemia-associated protein of 20 kDa (chains A)
SHMGAAALRSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDVTW

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Ubiquitin recognition by FAAP20 expands the complex interface beyond the canonical UBZ domain. Wojtaszek, J.L., Wang, S., Kim, H. et al. Nucleic Acids Res (2014) 42:13997-14005. DOI 10.1093/nar/gku1153 · PubMed

Other PDB entries of the same protein (UniProt Q6NZ36 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3WWQ 1.9 Å, Crystal structure of FAAP20 UBZ domain in complex with Lys63-linked diubiquitin
2MUR Solution Structure of the Human FAAP20 UBZ-Ubiquitin Complex

Browse structure collections

About this viewer

MolViewer shows 2MUQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.